SecReT6
Protein ID: 568140716
SecReT6 ID885
T6SS typei1
Gene symbol-
Locus tagU771_18865
StrainPseudomonas sp. TKP
Repliconchromosome [GenBank: NC_023064] [Browse all T6SS(s) in this replicon]
Location [Strand]4151692..4152528 [-]
Productserine/threonine protein kinase
NoteStk1
UniProt IDV9QZG6
KEGG IDpsk:U771_18865
PDB IDNA
Domain hit(s) vs Pfam Pkinase [PF00069], Evalue: 2.20E-35, Aligned region: 15..228
Pkinase_Tyr [PF07714], Evalue: 7.70E-21, Aligned region: 16..231
APH [PF01636], Evalue: 2.00E-05, Aligned region: 60..118
APH [PF01636], Evalue: 2.00E-05, Aligned region: 104..166
APH [PF01636], Evalue: 2.00E-05, Aligned region: 236..236
Protein Sequence: 278 a.a.     [Download]
>gi|568140716|ref|YP_008933301.1| serine/threonine protein kinase [Pseudomonas sp. TKP]
MSATVAPPSLLAGRYQLERILGSGGMGVVYRARDLLHEQFGEPCSSVALKVLGETFAECPDAHVLLYSEF
ALARGLRHERVVRMYGFDVDINRHIAFFTMELMHGMTLDRLLLEYPGGMPWRELQPMAVQLLDAVAYTHR
LGVLHGDLKPGNVMVSEEGLRLFDFGLGQSLLTTGLPGLSRGHIGAWTPAYAAPELLAGDALSMAADLYG
VACVLYEMAQGRRPGERSSAESLPRPRQWPRHYWPALRTALALDPERRTISVAELREMMGCPWRRWFV
 
Nucleotide Sequence: 837 bp     [Download]
>gi|568136993|ref|NC_023064.1|:c4152528-4151692 Pseudomonas sp. TKP, complete genome
ATGAGCGCGACCGTGGCCCCACCCAGCCTGCTCGCCGGGCGTTATCAGCTGGAGCGGATACTCGGCAGCG
GAGGCATGGGTGTGGTCTACCGCGCCCGTGACTTGCTGCACGAACAATTCGGCGAACCGTGTTCCAGTGT
GGCCTTGAAGGTCCTCGGCGAAACCTTTGCCGAGTGCCCGGACGCCCATGTGCTGTTGTACAGCGAGTTT
GCCCTGGCCCGCGGCCTGCGACATGAGCGGGTGGTGCGCATGTATGGATTCGACGTCGATATCAACCGGC
ATATCGCGTTCTTTACCATGGAGTTGATGCACGGCATGACCCTGGACCGACTGCTGCTCGAATACCCCGG
TGGCATGCCTTGGCGAGAACTGCAACCGATGGCGGTGCAGTTGCTCGACGCCGTGGCGTATACCCATCGC
CTGGGTGTGCTGCACGGCGATCTGAAGCCGGGCAACGTCATGGTCAGCGAGGAGGGCCTGCGGTTGTTCG
ATTTCGGCCTGGGGCAGTCGCTGCTCACGACCGGGTTGCCGGGCCTGAGCCGCGGCCATATCGGTGCCTG
GACACCCGCTTATGCCGCGCCGGAGCTGCTGGCCGGCGATGCGCTGTCAATGGCCGCCGACCTGTACGGC
GTGGCGTGCGTGCTTTACGAGATGGCGCAAGGACGGCGGCCGGGGGAGCGCTCATCCGCTGAGTCACTGC
CGCGGCCACGGCAATGGCCTCGGCATTATTGGCCGGCGTTACGCACGGCGCTGGCCCTGGACCCCGAGCG
TCGCACCATCAGCGTCGCTGAGTTGCGTGAGATGATGGGCTGCCCGTGGCGCCGTTGGTTTGTGTAG
 Primer design