SecReT6
Protein ID: 568140717
SecReT6 ID885
T6SS typei1
Gene symbol-
Locus tagU771_18870
StrainPseudomonas sp. TKP
Repliconchromosome [GenBank: NC_023064] [Browse all T6SS(s) in this replicon]
Location [Strand]4152525..4153256 [-]
Productprotein phosphatase
NoteStp1
UniProt IDV9QY79
KEGG IDpsk:U771_18870
PDB IDNA
Domain hit(s) vs Pfam PP2C_2 [PF13672], Evalue: 8.40E-17, Aligned region: 18..211
PP2C [PF00481], Evalue: 3.40E-14, Aligned region: 32..206
SpoIIE [PF07228], Evalue: 1.30E-10, Aligned region: 36..242
Protein Sequence: 243 a.a.     [Download]
>gi|568140717|ref|YP_008933302.1| protein phosphatase [Pseudomonas sp. TKP]
MSRHGIPWRSAGRTQRGKVRARNEDAFLDCPQRGCWAVADGMGGHRAGDVASQWVASSLASLSGQGSLDQ
RVEAVRRCLQSLNWQLGHGLRRPAGDLDGTMGSTVVTLLLEGSRAACVWAGDSRCYLWRGQNLYQLSRDH
SLLRQLMDEQQLSLEQARAHPDARALTRAIGAREPLNLEVLELSTRPGDVFLLCSDGLYQSLSHGELGRA
LSMGTPQQMVDRLFAAVMRGTARDDLTAVVVQS
 
Nucleotide Sequence: 732 bp     [Download]
>gi|568136993|ref|NC_023064.1|:c4153256-4152525 Pseudomonas sp. TKP, complete genome
GTGAGCCGCCATGGCATCCCTTGGCGCAGTGCGGGGCGTACGCAGCGCGGCAAGGTCAGGGCGCGTAACG
AGGACGCGTTCCTCGATTGCCCTCAACGCGGCTGTTGGGCGGTGGCGGACGGCATGGGCGGGCACCGGGC
CGGGGATGTGGCCAGCCAATGGGTGGCCAGCAGCCTGGCGTCCTTGTCGGGGCAGGGTAGCCTCGATCAG
CGCGTGGAAGCCGTTCGCCGATGCCTGCAATCGCTCAATTGGCAACTGGGCCATGGGCTGAGACGCCCCG
CAGGTGATCTCGACGGCACCATGGGCAGCACCGTCGTCACGCTACTGTTGGAGGGCAGTCGTGCTGCCTG
TGTGTGGGCGGGAGACAGCCGTTGCTACCTGTGGCGCGGGCAGAACCTGTATCAACTGTCCCGCGACCAC
TCCCTGCTTCGACAATTGATGGATGAACAACAGTTGAGCCTGGAGCAGGCCCGAGCCCACCCGGATGCGC
GGGCCTTGACGCGGGCCATCGGCGCCCGTGAGCCCTTGAACCTGGAAGTGCTGGAGCTCAGCACTCGGCC
AGGCGATGTGTTCCTGTTGTGCAGCGACGGTCTGTACCAGTCACTCAGTCATGGCGAGCTGGGACGTGCC
TTGAGCATGGGCACGCCGCAACAGATGGTGGACCGGTTGTTCGCCGCCGTCATGCGCGGCACGGCGCGGG
ACGACCTGACTGCTGTGGTGGTGCAGTCATGA
 Primer design