SecReT6
Protein ID: 568140718
SecReT6 ID885
T6SS typei1
Gene symbol-
Locus tagU771_18875
StrainPseudomonas sp. TKP
Repliconchromosome [GenBank: NC_023064] [Browse all T6SS(s) in this replicon]
Location [Strand]4153253..4156615 [-]
Producttype VI secretion protein VasK
NoteTssM
UniProt IDV9QZG8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.60E-65, Aligned region: 462..748
ImcF-related_N [PF14331], Evalue: 9.80E-58, Aligned region: 190..378
ImcF-related_N [PF14331], Evalue: 9.80E-58, Aligned region: 376..419
DUF1215 [PF06744], Evalue: 8.60E-36, Aligned region: 855..979
DUF4131 [PF13567], Evalue: 0.0011, Aligned region: 12..104
DUF4131 [PF13567], Evalue: 0.0011, Aligned region: 408..451
Protein Sequence: 1120 a.a.     [Download]
>gi|568140718|ref|YP_008933303.1| type VI secretion protein VasK [Pseudomonas sp. TKP]
MNAFFKGAGTVLATIWVWSLLLVLSVALLVWFFGPLLAVDGYRFWAAPTSRLLTVCVVFLLWGLAMVLAG
GRRAVRLKKPGHQAHHEQQGRIEDEQKQVRGRFREALHTLKTSGRYAERSERWRDELPWYLLIGEAGSGK
TRLLAASGLPFPLDRVEPSSTGQTRYCDWYFADDAVLVDTAGRYLTQPDGAVDAAGWLTLLRLLRARRQV
RPLNGVVVTLSMETLVGSHPLDLDHHARHIHTRLQEIQQTLHVDVPIYLVLTQADRLTGFAEYFDSPQAD
AAEGVLGQQLITGKAGTEVTQVRQAFETLLQRLGGELIQRLHAQRSVEQRGLTLDFPQQMARVGERLCAF
IELAFSAHRYQRINGLRGFYLTCAGERGSHFIQGLFNRVIFAEAGLAGLQGQEQQRIRRRQIGVAVAATL
IIGAAGWLWMHSYSVNHHRLQQLANLATPVALPLGTDATLAVLPLLDARRAAIQVFPAVQDVPLVERAGL
YQGEASQPVLDSAYEQALQQQLLPRVTELLEEQVRSSLDDRERLLDNLRAYLMLTLRERRDTAWLAQRVA
GHWSARYAGDTSTQHRLNVHLAQLLGQSFVAPVDDQLVALARQALRGESLADVIYRVLREQSRNLEPLRF
AEGKVFAAIDHPIPGFYTKRYLQYFETQGPRLVNAIAQDNWVLGEGTDLSAMDLRRLMLELEQRYFSEYA
DAWSDALGQVSLQATDGLRQGAEQLASLTSAQSPLIQLLQLVRENTRLLPVSERLDEVTRQIGEVGAVAQ
LASDALMEQLPPDSARRALQRRFEPLHQMLDERQNPGAELSQALRLADELHLQLTALNRESAPEQAAFQK
AIRRMEGQQDVLGNLRDAAARLPLPLSAWFEAIADDVWRHWLDEAYVYVNQRYQSEVYGVYAKAIRQRYP
FNAHGTSDVALSDFTDFFKPRGVMARFYDSYLRPFVSTEGSRYRLRGLDGRSFPTSRAFLDQLAKAQVIR
RGFFSEEQGGLSVRFTLAPYSLDQAVSRAILRIGDQQLEYRHGPIVPMAFHWPTEADNGRSSLVLERGAH
RPLGIEKNSGDWSLFRFFDLMQSEPANGRNAQILKSDLSGLRANYLLTSQRMPNPFQIAAWRTFRLPERL
 
Nucleotide Sequence: 3363 bp     [Download]
>gi|568136993|ref|NC_023064.1|:c4156615-4153253 Pseudomonas sp. TKP, complete genome
ATGAACGCATTCTTCAAGGGCGCGGGCACCGTGCTGGCTACGATTTGGGTCTGGAGCTTGTTGCTGGTGC
TTTCAGTCGCGCTGTTGGTATGGTTTTTCGGACCCTTGCTCGCGGTGGACGGGTATCGGTTCTGGGCCGC
ACCGACATCGCGCCTGTTGACCGTCTGCGTGGTGTTTCTGTTGTGGGGGCTGGCGATGGTCCTGGCCGGC
GGGCGCCGCGCCGTGCGGCTGAAAAAGCCCGGACACCAGGCGCATCATGAGCAACAGGGGCGCATTGAGG
ACGAGCAGAAACAAGTGCGTGGCCGCTTCAGGGAGGCGCTGCATACCCTGAAAACCTCTGGCCGGTATGC
TGAACGCAGCGAGCGTTGGCGTGATGAGCTGCCCTGGTACCTGTTGATCGGCGAGGCGGGCAGTGGCAAG
ACGCGCTTGCTGGCGGCCAGTGGGTTGCCGTTTCCGCTGGACCGTGTCGAGCCGAGTTCGACGGGCCAGA
CCCGCTACTGTGATTGGTACTTTGCCGACGACGCGGTGCTGGTCGATACCGCCGGACGCTACCTGACGCA
ACCGGACGGTGCCGTGGATGCCGCGGGCTGGTTGACCTTGCTCAGGCTGCTCAGGGCGCGACGCCAGGTC
CGCCCGCTCAATGGTGTCGTGGTGACCTTGTCGATGGAAACGCTGGTTGGCAGCCACCCGCTGGATCTGG
ACCATCACGCCCGTCACATTCACACGCGCTTGCAGGAAATCCAGCAGACGTTGCATGTCGATGTGCCGAT
CTACCTGGTCCTGACCCAGGCCGATCGGTTGACGGGGTTTGCCGAATACTTCGACTCACCCCAGGCCGAC
GCCGCCGAAGGCGTACTGGGTCAACAGCTGATCACCGGCAAGGCCGGCACTGAAGTCACCCAGGTGCGCC
AGGCGTTCGAGACGCTGCTGCAACGCCTGGGGGGGGAGTTGATTCAGCGCTTGCACGCGCAGCGCAGTGT
CGAGCAGCGCGGGCTGACACTCGACTTTCCGCAACAGATGGCGCGAGTCGGCGAACGCCTGTGCGCATTT
ATCGAGCTGGCTTTTTCCGCGCATCGTTATCAACGTATCAACGGACTGCGCGGGTTCTATTTGACCTGCG
CCGGTGAGCGCGGCTCGCACTTCATCCAGGGCTTGTTCAACCGGGTGATATTTGCCGAGGCCGGCCTCGC
CGGTCTGCAGGGCCAGGAACAGCAGCGCATACGTCGCCGGCAAATCGGCGTGGCCGTGGCCGCAACCCTG
ATCATCGGTGCGGCGGGTTGGCTGTGGATGCACAGTTATTCGGTCAACCATCATCGCTTGCAGCAACTGG
CCAACCTGGCGACGCCAGTTGCCTTGCCACTTGGTACGGACGCGACGCTGGCCGTGTTGCCGCTGCTGGA
TGCACGGCGGGCGGCGATCCAGGTTTTCCCCGCAGTGCAGGACGTGCCACTGGTGGAACGTGCAGGCTTG
TATCAGGGAGAAGCGAGTCAGCCGGTGCTGGACAGCGCTTATGAGCAGGCCCTGCAACAGCAGTTATTGC
CACGGGTGACCGAGTTGCTCGAAGAGCAGGTGCGTTCCAGCCTGGATGATCGCGAGCGGCTGTTGGACAA
CCTGCGTGCCTACCTGATGCTCACCTTGCGCGAGCGCCGTGATACGGCTTGGCTGGCGCAGCGAGTGGCT
GGCCATTGGTCGGCACGTTATGCGGGCGATACGTCGACACAGCACCGCCTGAATGTGCATCTGGCGCAGT
TGCTTGGGCAATCGTTCGTGGCACCGGTAGATGATCAACTGGTTGCCCTGGCGCGCCAGGCATTGCGCGG
TGAGTCGTTGGCCGATGTGATCTACCGGGTGCTGCGCGAGCAGTCGCGTAACCTGGAACCCTTGCGCTTT
GCCGAGGGCAAGGTATTTGCCGCCATCGATCATCCGATCCCCGGGTTCTACACAAAACGGTATTTGCAGT
ATTTCGAGACGCAGGGGCCGCGATTGGTGAATGCCATTGCCCAGGACAATTGGGTGCTGGGTGAAGGGAC
GGACTTGAGTGCCATGGATTTACGCCGGCTGATGCTTGAGCTCGAGCAGCGTTACTTCAGCGAGTACGCC
GACGCCTGGAGTGATGCATTGGGCCAGGTCAGCCTGCAGGCGACTGACGGCCTCAGGCAAGGTGCCGAGC
AACTTGCCAGCTTGACGTCCGCCCAGTCGCCCCTGATCCAGCTGTTGCAGTTGGTCAGGGAAAATACCCG
CTTGCTCCCTGTCAGCGAGCGACTGGATGAGGTGACGCGCCAGATCGGTGAGGTGGGCGCGGTGGCGCAG
TTGGCAAGCGACGCGCTAATGGAGCAGTTGCCGCCGGACTCGGCCCGGCGTGCGTTGCAGCGCCGCTTCG
AACCGTTGCACCAGATGCTGGACGAGCGGCAAAACCCCGGTGCCGAGTTAAGCCAGGCCCTGCGTCTGGC
CGACGAGTTGCACCTGCAACTGACGGCCCTGAACCGTGAGAGTGCGCCGGAGCAGGCGGCCTTCCAAAAG
GCTATACGGCGCATGGAGGGCCAGCAGGATGTGCTGGGCAATTTGCGTGATGCTGCTGCGCGTCTGCCAC
TGCCGCTGTCTGCCTGGTTCGAGGCCATTGCCGATGATGTCTGGCGCCACTGGTTGGATGAGGCCTATGT
GTATGTGAACCAGCGCTATCAAAGCGAGGTATACGGTGTGTATGCCAAGGCCATTCGCCAGCGGTACCCG
TTCAATGCCCACGGTACCAGCGATGTGGCGCTCAGTGATTTCACCGATTTTTTCAAGCCTCGAGGTGTGA
TGGCGCGGTTCTATGACAGTTACCTGCGCCCGTTTGTCAGCACCGAGGGCAGCCGCTACCGCTTGCGCGG
CCTGGACGGGCGCAGCTTTCCGACATCACGTGCTTTCCTGGACCAACTGGCGAAGGCGCAAGTGATCCGG
CGCGGTTTTTTTTCCGAGGAGCAAGGAGGCTTGTCCGTGCGCTTTACCCTGGCCCCCTACAGCCTGGACC
AGGCGGTCAGTCGCGCCATCCTGCGTATTGGCGATCAACAACTGGAATATCGCCACGGCCCCATCGTGCC
CATGGCGTTTCATTGGCCCACCGAGGCCGACAACGGTCGCAGCAGCCTGGTCCTGGAGCGGGGCGCGCAT
CGACCCCTGGGGATCGAGAAAAACAGCGGAGATTGGTCATTGTTCCGCTTCTTCGATTTGATGCAGAGCG
AGCCCGCCAATGGCCGGAACGCGCAGATACTCAAGTCTGACCTCTCGGGTTTGCGCGCCAATTACCTGTT
GACCAGCCAGCGCATGCCCAACCCATTTCAAATCGCGGCCTGGCGCACGTTCCGCTTGCCGGAGCGACTG
TGA
 Primer design