SecReT6
Protein ID: 568140724
SecReT6 ID885
T6SS typei1
Gene symbol-
Locus tagU771_18905
StrainPseudomonas sp. TKP
Repliconchromosome [GenBank: NC_023064] [Browse all T6SS(s) in this replicon]
Location [Strand]4160689..4162215 [-]
ProductFis family transcriptional regulator
NoteSfa2
UniProt IDV9QZN6
KEGG IDpsk:U771_18905
PDB IDNA
Domain hit(s) vs Pfam Sigma54_activat [PF00158], Evalue: 1.40E-69, Aligned region: 198..365
Sigma54_activ_2 [PF14532], Evalue: 8.30E-22, Aligned region: 199..369
HTH_8 [PF02954], Evalue: 4.50E-12, Aligned region: 355..362
HTH_8 [PF02954], Evalue: 4.50E-12, Aligned region: 457..497
AAA_5 [PF07728], Evalue: 1.10E-06, Aligned region: 222..340
HTH_30 [PF13556], Evalue: 2.30E-06, Aligned region: 451..468
HTH_30 [PF13556], Evalue: 2.30E-06, Aligned region: 471..497
GAF_3 [PF13492], Evalue: 4.20E-06, Aligned region: 39..158
GAF_3 [PF13492], Evalue: 4.20E-06, Aligned region: 205..256
GAF_2 [PF13185], Evalue: 5.90E-05, Aligned region: 30..151
GAF_2 [PF13185], Evalue: 5.90E-05, Aligned region: 285..286
Protein Sequence: 508 a.a.     [Download]
>gi|568140724|ref|YP_008933309.1| Fis family transcriptional regulator [Pseudomonas sp. TKP]
MMKSLFTPLPHPLTYAETLLGWFCRLGHEHDETTLADLCVTGAAQLSQCELSQLYLFDEPAGRLELIAQH
LHGALPPGDPASGPGSQREPLLHYVLTQGQPLTLHDLSQCVHDIGFLPAVAQPWHCLSCIPLLGRSKTIM
GVLLCASPRPAQLQGYVASLARLGGFALAQLSLLRRMQPASEVTRLKSRAPATRVYGLIGNSVAMNETCR
LIGKVLHTPYTVLLRGETGTGKEVVARAIHAAGPRSAKAFVVQNCAAFPEGLLESELFGYRKGAFTGAQR
DHVGLFDAAHGGTLLLDEIGDMPLSLQAKLLRVLQEGEVRPLGANASHKVDVRIIAATHRDLLAMVAQGT
FREDLYYRLAQFPIELPALRERDGDALQLARHFADEACMALGRPAVGWSSAALDQLTSHGFPGNVRELKC
LVERAVLLCDDGVILPLHLALSPRTEAAVETTLRQRLERVERMVLIDCLQKNRGNRTRTARELGVARRTL
LYRLARLNIPVGEAKGEC
 
Nucleotide Sequence: 1527 bp     [Download]
>gi|568136993|ref|NC_023064.1|:c4162215-4160689 Pseudomonas sp. TKP, complete genome
ATGATGAAAAGCCTGTTTACCCCATTACCCCATCCCCTGACCTATGCCGAGACCTTGCTCGGCTGGTTCT
GCCGACTGGGCCATGAACACGACGAAACCACGCTGGCGGACTTGTGCGTGACCGGCGCTGCGCAACTGAG
CCAGTGTGAACTCAGCCAGCTGTACCTGTTCGATGAGCCGGCGGGCAGGCTTGAGCTGATCGCCCAGCAT
CTCCACGGGGCGCTGCCGCCGGGCGACCCAGCGTCGGGCCCTGGCTCCCAGCGTGAACCTCTGTTGCACT
ACGTGCTGACCCAAGGGCAGCCCCTTACCCTGCATGACCTGAGCCAGTGCGTGCATGACATCGGGTTCCT
GCCGGCAGTGGCGCAGCCTTGGCATTGCCTGTCCTGCATACCGCTGCTGGGGCGCAGCAAAACCATCATG
GGGGTATTGCTGTGCGCCAGCCCGCGCCCAGCCCAATTGCAAGGTTATGTTGCCTCGCTGGCGCGCCTTG
GCGGCTTCGCGCTGGCGCAATTGAGCCTGTTGCGACGGATGCAGCCCGCATCGGAGGTCACCCGGCTCAA
ATCGAGAGCGCCCGCCACTCGTGTGTACGGCTTGATCGGCAACAGTGTTGCGATGAACGAGACCTGCCGC
TTGATCGGTAAGGTCCTGCACACGCCGTACACCGTGTTGCTGCGTGGCGAGACCGGTACCGGCAAGGAAG
TGGTGGCGCGGGCCATCCACGCCGCCGGGCCGCGCAGCGCTAAAGCGTTCGTGGTGCAGAACTGCGCCGC
GTTTCCGGAAGGCCTGTTGGAGAGCGAGCTGTTCGGCTACCGCAAGGGCGCATTTACCGGGGCCCAGCGC
GACCACGTCGGGTTATTCGATGCAGCCCATGGCGGCACGCTGCTGTTGGATGAAATCGGTGACATGCCGC
TCTCACTGCAGGCCAAGTTGCTGCGCGTTTTGCAGGAAGGAGAAGTGCGTCCGCTGGGGGCCAATGCTTC
CCATAAGGTCGATGTCCGCATCATCGCGGCGACTCACCGTGACCTGCTTGCCATGGTGGCCCAGGGGACC
TTCCGCGAAGACCTGTATTACCGGCTGGCGCAGTTTCCCATCGAGTTGCCGGCGCTGCGTGAGCGCGACG
GCGACGCGCTGCAACTGGCGCGTCATTTCGCCGACGAGGCCTGTATGGCACTCGGTCGGCCAGCTGTTGG
CTGGTCAAGCGCGGCCCTGGATCAACTGACGAGTCATGGCTTCCCCGGCAATGTCCGCGAACTCAAGTGC
CTGGTGGAGCGCGCGGTGCTGCTGTGTGATGACGGTGTGATCCTGCCGCTGCACCTGGCGCTGTCGCCGC
GAACGGAGGCCGCTGTAGAGACCACATTACGCCAGCGCCTGGAGAGGGTGGAGCGCATGGTCCTGATCGA
TTGCCTGCAGAAGAACCGTGGTAATCGAACACGCACCGCCCGTGAGCTGGGCGTCGCTCGCCGCACGCTG
CTCTACCGGCTTGCCCGCTTGAATATTCCTGTTGGTGAAGCCAAGGGGGAGTGCTGA
 Primer design