SecReT6
Protein ID: 568143106
SecReT6 ID886
T6SS typei3
Gene symbol-
Locus tagU771_31085
StrainPseudomonas sp. TKP
Repliconchromosome [GenBank: NC_023064] [Browse all T6SS(s) in this replicon]
Location [Strand]6792971..6796471 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDV9R792
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.20E-97, Aligned region: 73..122
ImcF-related_N [PF14331], Evalue: 1.20E-97, Aligned region: 188..450
IcmF-related [PF06761], Evalue: 1.20E-89, Aligned region: 499..794
DUF1215 [PF06744], Evalue: 8.60E-41, Aligned region: 689..725
DUF1215 [PF06744], Evalue: 8.60E-41, Aligned region: 904..1025
AAA_19 [PF13245], Evalue: 0.0047, Aligned region: 124..141
AAA_16 [PF13191], Evalue: 0.0058, Aligned region: 122..250
AAA_16 [PF13191], Evalue: 0.0058, Aligned region: 405..420
AAA_16 [PF13191], Evalue: 0.0058, Aligned region: 618..640
AAA_16 [PF13191], Evalue: 0.0058, Aligned region: 769..801
Protein Sequence: 1166 a.a.     [Download]
>gi|568143106|ref|YP_008935691.1| type VI secretion protein IcmF [Pseudomonas sp. TKP]
MKAFFSFMIRWVIPVLGLIALSLIIWFVGPLLDGLVPEGRRWALIVLIFAVWIAYRVFRIIQARRQAAEV
MRSLAAETPADPNSVATAEELSSLRQRMDEALALLKKAKLGGDERRNLYELPWYVIIGPPGSGKTTALVN
SGLHFPLAAQLGAGAVRGVGGTRNCDWWFTDQAVLLDTAGRYTTQDSNSTVDKAAWLGFLDLLKKQRSRR
PIDGAFIAISLSDLLLGTDAERAAHAAAIRLRIQELYTQLGVRFPIYLMLTKLDLVPGFMEFFDNLSKEE
RAQVWGMTFALDDGKNSDSPLAHLQSEFAGLEQRLNERLVERLQQERDPARRDLIYGFPQQFGALKDCLQ
SFLEGVFKPNAFEERVLLRGVYFTSGTQEGSPIDRLIGAMAQSMNLDRQHLARQSGTGRSYFIEKLFTAV
AFAERGLVGVNPKVERRRKWIARGVLAATVALVIVVSSLWWVSYRANQAYIAQVDQKVAPLGQTVQNLSP
AQREVLAVLPLLNAVKNLAGDSPSWSEGLGLYQGDMLEAESASVYRKLLIAVFAPRLVTRIEEQLHGGGN
SDFLYEGLKAYLMLADTEHYDPDFIKAWIALDWDRNLPRDLPADQRQALAGHLQALFERHPPSARLDPRL
IDDLRRQLQQLPVAQRVYDRVKRQKLPEGIPDFRINEAAGRDAALVFSRKSGKPLGEPLSGFFTAKGYRQ
AFLLSSLNQTGTLAEEQWVLGREQADQQNVVSLAADVRRLYFQDYQRQWDALLADIDFVPITSVAQAADV
LRVISGPTSPLKKLLVAVAKETDLQAEERQLAAKGVPVEGGVDKLKERLGSLLGQEQPTANAPAAADDPV
TAHFAELNSIVSKNEGEPAAIDGLLSDMNALYVQVSAMVGASGDALLGEAKNQAAAAATRVSLNAERQPP
LVQGMVKSVVNSTTNSMMGGVRNQLNAAWVSEVVNVYRQSLAGRYPMSPGSTRDATLDDFGQFFGVGGVM
DNYFRKYLQPYVDTSAQTWRWQPGAAQKLGIAPGVLQTFQRAATIRDAFFRSGGTQPIVRFELKPVSMDP
SITQFLLDLDGQQLSYDHGPSRPVAMQWPNPGSIGVVRISIMPPSASGRSGVTLDGPWAWFRLLEQSDLT
AGNSPDRFNLRLRVDGASIAYELRANSAFNPFKSRVLSGFSLPERL
 
Nucleotide Sequence: 3501 bp     [Download]
>gi|568136993|ref|NC_023064.1|:c6796471-6792971 Pseudomonas sp. TKP, complete genome
GTGAAGGCGTTTTTCAGTTTCATGATTCGCTGGGTGATCCCCGTACTGGGCCTGATCGCCCTGAGCCTGA
TCATCTGGTTTGTGGGGCCGCTGCTCGATGGGCTGGTTCCGGAAGGGCGGCGCTGGGCGCTGATCGTGCT
GATCTTTGCGGTGTGGATTGCCTATCGGGTGTTCCGCATCATCCAGGCGCGCCGTCAGGCGGCCGAAGTG
ATGCGCAGCCTGGCGGCGGAAACCCCGGCCGACCCCAACAGCGTGGCCACCGCCGAAGAATTGTCGAGCT
TGCGCCAGCGCATGGACGAAGCCTTGGCCCTGTTGAAAAAGGCCAAGCTTGGTGGTGACGAACGCCGCAA
TCTCTATGAGCTGCCGTGGTACGTGATCATCGGCCCGCCAGGCTCGGGCAAGACCACTGCGCTGGTCAAT
TCCGGGCTGCATTTCCCGCTGGCCGCGCAACTGGGCGCCGGTGCGGTGCGTGGTGTCGGCGGCACGCGCA
ATTGCGACTGGTGGTTTACCGACCAGGCGGTATTGCTCGACACCGCAGGCCGCTATACCACCCAGGACAG
CAATTCCACGGTGGATAAAGCCGCCTGGCTGGGCTTTCTCGACCTGCTGAAAAAGCAGCGCTCGCGTCGC
CCGATCGATGGTGCCTTTATCGCTATCAGCCTCTCGGACCTGCTGCTGGGTACCGACGCCGAACGCGCCG
CCCATGCGGCGGCGATCCGCCTGCGTATCCAGGAGCTGTACACCCAATTGGGCGTGCGTTTCCCGATCTA
CCTGATGCTGACCAAGCTCGACCTGGTGCCGGGCTTCATGGAGTTCTTCGACAACCTGAGCAAGGAAGAA
CGCGCCCAGGTGTGGGGCATGACCTTTGCCCTGGATGACGGCAAGAACAGCGACAGCCCGCTGGCCCACC
TGCAAAGCGAATTCGCCGGCCTGGAACAGCGCCTCAACGAACGCCTGGTGGAGCGCCTGCAACAGGAGCG
CGACCCGGCGCGGCGCGACCTGATCTACGGTTTCCCGCAACAGTTCGGCGCCCTGAAGGATTGCCTGCAA
AGCTTCCTCGAAGGCGTATTCAAGCCCAACGCCTTTGAAGAACGCGTGTTGCTGCGCGGGGTGTACTTCA
CCAGCGGTACCCAGGAAGGCAGCCCAATTGACCGCCTGATTGGCGCCATGGCCCAGAGCATGAACCTGGA
CCGCCAGCACCTGGCGCGCCAGAGCGGTACCGGGCGCAGTTACTTCATCGAAAAACTCTTCACCGCCGTG
GCTTTTGCCGAACGTGGACTGGTGGGTGTGAACCCGAAAGTTGAGCGCCGGCGCAAGTGGATCGCACGCG
GTGTGCTCGCGGCCACCGTGGCCTTGGTGATCGTGGTCAGCAGCTTGTGGTGGGTGAGTTATCGCGCCAA
CCAGGCGTATATCGCCCAGGTCGACCAGAAGGTCGCGCCCCTGGGCCAGACCGTCCAGAACCTCAGCCCG
GCGCAGCGCGAAGTGCTGGCCGTGCTACCGCTGCTCAATGCGGTGAAGAACCTGGCAGGCGATTCGCCCA
GCTGGTCCGAGGGCCTTGGGCTGTATCAAGGCGACATGCTGGAAGCCGAGTCCGCCAGCGTCTACCGCAA
GCTGCTGATCGCGGTCTTCGCGCCACGCCTGGTGACGCGTATCGAAGAGCAACTGCACGGCGGCGGCAAT
TCCGACTTCCTTTACGAGGGCCTCAAGGCCTACCTGATGCTCGCCGACACCGAGCATTACGACCCGGACT
TCATCAAGGCCTGGATCGCCCTCGATTGGGACCGCAACCTGCCCCGTGACCTGCCCGCCGATCAGCGCCA
GGCGTTGGCCGGGCACCTGCAGGCGTTGTTCGAACGGCACCCGCCGAGCGCACGCCTCGATCCGCGTTTG
ATCGACGACCTGCGTCGCCAGTTGCAACAACTGCCGGTGGCCCAGCGTGTCTACGACCGGGTCAAACGTC
AGAAATTGCCTGAAGGCATCCCGGACTTCCGCATCAACGAAGCCGCCGGCCGTGATGCTGCGCTGGTGTT
CAGCCGCAAAAGTGGCAAGCCGCTGGGTGAGCCGCTGAGTGGTTTCTTTACCGCCAAGGGCTATCGCCAG
GCGTTCCTGCTGAGCAGCCTGAACCAGACCGGTACCCTGGCCGAAGAGCAATGGGTACTGGGCCGTGAGC
AGGCCGATCAGCAGAACGTGGTCAGCCTGGCCGCCGATGTGCGTCGCCTGTACTTCCAGGACTACCAGCG
CCAGTGGGACGCGTTGCTCGCCGACATCGACTTTGTACCGATCACCAGCGTGGCCCAGGCAGCCGATGTG
CTGCGGGTGATTTCCGGACCCACCTCGCCGCTGAAAAAACTGCTGGTGGCGGTGGCCAAGGAAACCGACC
TGCAAGCGGAAGAGCGCCAATTGGCCGCCAAGGGTGTACCGGTGGAAGGTGGGGTGGACAAGCTCAAGGA
GCGCCTGGGCAGCCTGCTCGGCCAGGAGCAACCGACCGCGAATGCCCCGGCCGCCGCGGATGATCCGGTG
ACCGCACACTTCGCCGAACTCAACAGCATCGTCAGCAAGAACGAAGGCGAACCGGCTGCCATCGACGGCC
TGTTGTCGGACATGAATGCGCTATATGTGCAGGTCAGCGCCATGGTCGGTGCCAGCGGCGACGCCTTGCT
GGGTGAGGCGAAGAACCAGGCGGCGGCTGCGGCCACGCGGGTCAGCCTGAATGCCGAGCGCCAGCCACCT
TTGGTGCAAGGCATGGTCAAGTCGGTGGTCAACTCCACCACCAACAGCATGATGGGCGGTGTGCGTAACC
AACTGAACGCGGCCTGGGTCAGCGAAGTGGTCAACGTGTATCGTCAGTCCCTGGCAGGGCGCTACCCGAT
GTCGCCGGGCAGTACGCGTGACGCCACCCTGGATGACTTCGGGCAGTTCTTTGGCGTGGGCGGGGTGATG
GACAATTACTTCCGCAAGTACCTGCAGCCGTATGTGGACACCTCGGCGCAGACCTGGCGCTGGCAGCCGG
GCGCGGCGCAGAAGCTCGGGATTGCACCGGGCGTGCTGCAAACCTTCCAGCGTGCCGCGACGATCCGCGA
TGCGTTCTTCCGCTCCGGGGGTACCCAACCCATCGTGCGCTTCGAACTCAAGCCAGTGTCGATGGACCCG
AGCATTACCCAGTTCCTGCTTGACCTTGACGGCCAGCAACTGAGCTACGACCACGGCCCGAGCCGCCCGG
TGGCGATGCAATGGCCAAACCCCGGCAGCATTGGTGTGGTGCGAATTTCCATCATGCCGCCGTCGGCCAG
TGGCCGCTCCGGTGTGACCCTGGATGGCCCGTGGGCTTGGTTCCGCCTGTTGGAGCAATCGGACCTTACC
GCCGGCAACTCGCCTGATCGCTTTAACCTGCGCCTGCGTGTGGATGGGGCGAGCATCGCCTACGAGTTGC
GCGCCAACAGCGCCTTCAATCCGTTCAAGAGTCGCGTGCTCAGCGGCTTCAGCCTGCCGGAGCGGTTATG
A
 Primer design