SecReT6
Protein ID: 568182403
SecReT6 ID890
T6SS typei4b
Gene symbol-
Locus tagX969_13615
StrainPseudomonas monteilii SB3078
Repliconchromosome [GenBank: NC_023075] [Browse all T6SS(s) in this replicon]
Location [Strand]2829174..2832977 [+]
ProductImcF-like family protein
NoteTssM
UniProt IDV9UKG8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 4.00E-60, Aligned region: 181..435
IcmF-related [PF06761], Evalue: 2.80E-45, Aligned region: 491..555
IcmF-related [PF06761], Evalue: 2.80E-45, Aligned region: 635..878
DUF1215 [PF06744], Evalue: 4.00E-23, Aligned region: 317..343
DUF1215 [PF06744], Evalue: 4.00E-23, Aligned region: 780..821
DUF1215 [PF06744], Evalue: 4.00E-23, Aligned region: 1011..1126
AAA_16 [PF13191], Evalue: 0.00031, Aligned region: 112..258
AAA_16 [PF13191], Evalue: 0.00031, Aligned region: 458..478
AAA_16 [PF13191], Evalue: 0.00031, Aligned region: 889..938
Protein Sequence: 1267 a.a.     [Download]
>gi|568182403|ref|YP_008955026.1| ImcF-like family protein [Pseudomonas monteilii SB3078]
MKTLLRLLKNFWFLLLLLWLASLLTCWLVAPLLPWLQQHLPEALAIISACFLLVIVLRQYQRIRAEHNLE
NLLQIEVDRSWNATGEFRDQQVLRERLKHAIAMLRTDRSAGGGGKAALSDLPWYLVVGMSAAGKTSLLTH
SGLSASIATANDSESGTQHCDWYFSPDAVMIDTAGRYLRDDQSASEFSAFLRMLRKQRGKAAINGLVMVV
SLPELLAANSDERNALAAQLVARVEEYAECLDANPPVYLMLSKTDQLPGFSQAFDGLDLHERQQPLGMTF
GLSEIRNNGLHAVLQTRLGNLQNHIRQHVDAQVIALGAEADSTLLNFPQYFAALSGVLEQFLEHFTRGHR
GGAPLLLRGLYFTSALQTGQQLGQVYEDVIADEFALQAAYDEHAENVGKAAGNRSYFITDTFRQVIFPDR
DLTLYQSRLGRQAAFSPLLLGLAAATGLLFIGWQALSFSNNRQWLDSLRGQLAQIEQAEDREQQLAAGKG
LEVLREQMARVENHRLQGVPLQLGGGLYHGEAIHQVTRTAYLAQLRSQALEPIARSLQVQMRAFNTFANG
INQELEFTPAPTPKKRNGKPLAPAIAAKAQAALGNSRAGAYAAKVNLATASDAAELSATTGGLSLSEEML
GRLDEQQVASIIDAYNTLKLYLLLTEPQGHPDPAFVAANLPQAWASAATEGTPADAAVIAENAPLYVQLL
EQGQAPSLPRNEQLINETRQNLKSFMISSSLVDREYLRLQLESSRQFPALSLNDLVPQPGRALLYGSAGV
PAIYTRQGWDTFVKPELIKLVSGNLRNESDWVLDGEGGDAIVQKANFVREFMTRYKRDYTQAWYKMVSSV
GVRHFADLASATQQLGLLSDVQNSPVKNLLAAVNDNTQWDLPVKHAIPALGSTREDGFWSKVSGLFDDKD
ALPANVAPALPAVDDGSLAKRFEPVARVFAENNAEGADSTIMDRYLAALRKLKVRMNNIQRSQDVGKSSK
QLISETLEGQPSEVTTVRNYVESSVDTSQDGLSRSLQGLFSLPIQYAWATLRDPAGQQIAKAWAQQIAKP
WEQVMAHRYPIAGSSRNEASVKDLQRFVDPDSGLLPAFKRNEIGNLAGGEGLGVGDGKAPALVNPGMLNS
IDKASSVGQVIASLSDRDNGFEIMLEPSANFTDIVFTLDGQEQHYRNGRSSWNRFAWPGTSNAPGARLDV
VTLSGARVTVFDFPGRWGLLRMNESARVEDLDGIQQRFSWNTASGRVSLVVRNFGGVKLTDLGDVKALSA
LNDRGAQ
 
Nucleotide Sequence: 3804 bp     [Download]
>gi|568179884|ref|NC_023075.1|:2829174-2832977 Pseudomonas monteilii SB3078, complete genome
ATGAAAACATTATTGCGCCTTTTGAAGAATTTCTGGTTTCTCCTGCTGCTGCTGTGGCTGGCGAGCCTGT
TGACCTGCTGGTTGGTCGCCCCGTTGCTGCCATGGCTGCAACAGCACCTGCCCGAAGCACTGGCAATCAT
CAGCGCCTGCTTCCTGCTGGTGATCGTGCTGCGCCAATACCAGCGCATTCGCGCCGAGCACAACCTGGAG
AACCTGCTGCAGATCGAGGTTGATCGCTCGTGGAATGCCACTGGCGAGTTCCGTGACCAGCAGGTGCTGC
GCGAACGCCTCAAGCATGCCATTGCCATGTTGCGCACCGACCGCTCCGCTGGAGGCGGTGGCAAGGCGGC
ACTGTCCGATTTGCCCTGGTACCTGGTGGTTGGCATGTCGGCAGCCGGCAAGACCTCGCTGCTGACCCAT
TCCGGCCTGTCGGCCAGCATTGCCACGGCCAACGACAGCGAAAGCGGCACCCAGCACTGCGACTGGTACT
TCAGCCCCGACGCGGTAATGATCGACACCGCCGGCCGCTATTTGCGTGATGACCAGTCGGCCAGCGAGTT
CTCGGCCTTCCTGCGCATGCTGCGCAAGCAGCGCGGCAAGGCAGCGATCAATGGCCTGGTAATGGTGGTC
AGCCTGCCCGAGCTGCTGGCGGCCAACAGCGACGAACGCAATGCCCTGGCGGCCCAGCTGGTGGCGCGGG
TGGAAGAGTATGCCGAGTGCCTCGACGCCAACCCGCCGGTCTACCTGATGCTGAGCAAGACCGACCAGTT
GCCGGGCTTCAGCCAGGCGTTCGACGGCCTCGATCTGCATGAACGCCAGCAACCGCTGGGCATGACCTTC
GGCCTGTCGGAAATCCGCAACAACGGCCTGCACGCCGTGCTGCAGACGCGCCTGGGCAACCTGCAGAACC
ACATTCGCCAGCATGTCGACGCGCAGGTGATCGCCCTCGGTGCCGAAGCCGACAGCACCCTGTTGAACTT
CCCGCAATACTTCGCCGCACTCAGCGGTGTCCTCGAGCAGTTCCTGGAGCACTTCACCCGCGGCCATCGC
GGCGGTGCCCCGCTGCTGCTGCGCGGCTTGTACTTCACCAGTGCCCTGCAGACCGGGCAGCAGCTGGGCC
AGGTATACGAAGACGTCATCGCCGACGAATTCGCCCTGCAAGCCGCCTACGATGAGCACGCCGAGAACGT
CGGCAAGGCCGCGGGCAACCGCAGCTACTTCATCACCGACACCTTCCGCCAGGTGATATTCCCCGATCGC
GACCTGACCCTGTACCAGTCGCGCCTGGGCCGCCAGGCTGCGTTCAGCCCGCTGCTGCTGGGCCTGGCCG
CCGCGACCGGGTTGCTGTTCATCGGTTGGCAGGCACTGTCGTTCTCCAATAACCGCCAATGGCTGGACAG
CCTGCGCGGGCAGCTGGCGCAGATCGAGCAGGCAGAAGACCGCGAGCAGCAGCTGGCCGCTGGCAAGGGC
CTGGAAGTGCTGCGCGAACAGATGGCCCGCGTCGAAAACCATCGCCTGCAGGGTGTACCACTGCAGTTGG
GGGGTGGCCTGTACCATGGCGAAGCCATCCACCAGGTGACTCGCACCGCCTACCTGGCGCAACTGCGCAG
CCAGGCGCTGGAGCCGATCGCACGCAGCCTGCAAGTACAGATGCGGGCCTTCAACACCTTCGCCAACGGT
ATCAACCAGGAGCTGGAATTCACCCCGGCCCCGACACCGAAAAAACGCAATGGCAAGCCGCTGGCCCCGG
CCATTGCAGCCAAGGCCCAGGCTGCGCTGGGCAACAGCCGCGCCGGTGCCTATGCCGCCAAGGTCAACCT
GGCCACCGCCAGCGATGCCGCCGAGCTGTCTGCCACCACCGGTGGCCTGTCACTGTCCGAAGAAATGCTC
GGGCGCCTCGACGAACAGCAGGTGGCCTCGATCATCGATGCCTACAACACCCTCAAGCTGTACCTGTTGC
TGACCGAGCCCCAAGGCCATCCGGACCCGGCCTTCGTCGCTGCCAACCTGCCCCAGGCCTGGGCCAGCGC
CGCCACCGAAGGCACTCCGGCCGACGCAGCCGTGATCGCAGAAAATGCCCCGCTGTACGTACAGTTGCTG
GAACAAGGCCAGGCGCCGTCGTTGCCGCGTAACGAACAGCTGATCAACGAAACCCGGCAAAACCTCAAGT
CGTTCATGATCTCCAGCTCGCTGGTCGATCGCGAGTACCTGCGCCTGCAACTCGAGTCGAGCCGCCAGTT
CCCGGCACTGAGCCTGAACGACCTGGTGCCGCAACCGGGCCGCGCGTTGCTGTATGGCTCTGCTGGTGTA
CCGGCAATCTATACCCGCCAGGGCTGGGACACCTTCGTCAAGCCGGAACTGATCAAGCTGGTGTCGGGCA
ACCTGCGCAACGAGTCGGACTGGGTGCTGGACGGTGAAGGTGGCGATGCCATCGTGCAAAAGGCCAACTT
CGTGCGCGAGTTCATGACCCGCTACAAGCGCGACTACACCCAGGCCTGGTACAAGATGGTCAGCAGTGTG
GGGGTACGCCACTTCGCGGACCTGGCCTCGGCCACCCAGCAGCTGGGGCTGCTCAGCGACGTGCAGAACT
CGCCGGTAAAGAACCTGCTGGCGGCGGTCAATGACAACACCCAGTGGGACCTGCCGGTCAAGCACGCCAT
CCCGGCCCTCGGTAGTACCCGCGAAGACGGCTTCTGGAGCAAGGTCTCCGGCCTGTTCGACGACAAGGAC
GCCCTGCCCGCCAACGTCGCCCCGGCCCTGCCGGCGGTGGACGACGGCAGCCTGGCCAAGCGCTTCGAAC
CGGTGGCGCGGGTATTTGCCGAAAACAACGCCGAAGGCGCCGACAGCACCATCATGGACCGCTACCTGGC
CGCCTTGCGCAAGCTCAAGGTGCGCATGAACAACATCCAGCGTTCGCAGGATGTGGGCAAGAGCAGCAAG
CAGCTGATCAGCGAGACCCTGGAAGGCCAGCCGAGCGAAGTCACCACCGTGCGCAACTATGTGGAAAGCA
GCGTCGACACCAGCCAGGACGGCCTGTCGCGCTCGCTGCAGGGGCTGTTCAGCCTGCCTATCCAGTATGC
CTGGGCGACCCTGCGCGACCCGGCCGGCCAGCAGATCGCCAAGGCCTGGGCGCAGCAGATCGCCAAGCCT
TGGGAACAGGTCATGGCGCACCGCTACCCGATTGCCGGCAGCAGCCGCAACGAGGCGTCGGTAAAGGACC
TGCAGCGCTTCGTCGACCCCGACAGCGGCCTGCTGCCGGCCTTCAAGCGCAACGAAATCGGCAACCTGGC
CGGGGGTGAAGGCCTGGGTGTGGGCGACGGCAAGGCACCGGCGCTGGTCAACCCAGGCATGCTCAACAGC
ATCGACAAGGCCAGCTCCGTGGGCCAGGTGATCGCCAGCCTGTCGGACCGTGACAACGGCTTCGAAATCA
TGCTGGAACCTTCTGCCAACTTCACCGACATCGTGTTCACCCTCGATGGCCAGGAACAGCACTACCGCAA
CGGCCGCAGTAGCTGGAACCGCTTCGCCTGGCCGGGCACCAGCAACGCTCCGGGTGCCCGCCTGGATGTG
GTCACCCTCAGTGGCGCGCGGGTCACCGTGTTCGACTTCCCCGGGCGCTGGGGCCTGCTGCGCATGAACG
AAAGCGCCCGGGTCGAGGACCTGGACGGCATTCAGCAACGCTTCAGCTGGAACACCGCCAGCGGCCGCGT
GAGCCTTGTAGTGCGTAACTTCGGTGGGGTGAAACTGACCGACCTGGGTGATGTCAAGGCGCTGAGCGCC
CTCAACGACAGGGGCGCCCAATGA
 Primer design