SecReT6
Protein ID: 568187783
SecReT6 ID891
T6SS typei4b
Gene symbol-
Locus tagX970_13270
StrainPseudomonas monteilii SB3101
Repliconchromosome [GenBank: NC_023076] [Browse all T6SS(s) in this replicon]
Location [Strand]2783757..2786252 [+]
Productmembrane protein
NoteTssM
UniProt IDV9V381
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.00E-67, Aligned region: 83..112
ImcF-related_N [PF14331], Evalue: 2.00E-67, Aligned region: 189..453
OmpA [PF00691], Evalue: 9.20E-16, Aligned region: 716..811
IcmF-related [PF06761], Evalue: 2.70E-08, Aligned region: 95..132
IcmF-related [PF06761], Evalue: 2.70E-08, Aligned region: 323..334
IcmF-related [PF06761], Evalue: 2.70E-08, Aligned region: 507..640
Protein Sequence: 831 a.a.     [Download]
>gi|568187783|ref|YP_008960396.1| membrane protein [Pseudomonas monteilii SB3101]
MNKIKYYCLRYQPYLLGVAFFLAIFLVWAIGCALGFASLHSLLAGIGVFLLLSAGYVLLLYRGAGQHHNL
EGLLRDDADQAVLNATPADREEVSLLRERLLQSIERLRSNTPRGTSAKDALYALPWYLVIGQPAAGKSTM
ILQSGLNFPYAEREGARVAGLGGTRNCDWFFSSEAVLLDTAGRYMNSPEEAGKWRGFLQLLRQHRQRRPL
NGLIVSVSIADILHGSAEDQDRVAKRLRERIQESCALLEVRLPIYLVFTKCDLIPGFTPFYRQLDDAARG
EVMGKTFSHKGYEQADWGQRFGKAMDELTGYWQQVANQQLVQQDIQVTRQNNAAYRFPLELAALKPRLQQ
FVDSLLRANPYQNAEMLRGFYFTAALQADEALWGSHGQHVAERFALEHAEGTATAVSQPAPLFINSLFRK
VIIPDQHLVALYTSNTRERRRKAGWVAATGLAALVLCSLWGWSYLNNRAILANIAGELAQAKADDQAARG
QYAAWHSLDRLRFWAEHYYRQHREQGVPLGMRLGLYQGHEVEPLLRSRYFATLQNVMLKPTADNLTRTLY
LLTTIKVYQRNTRELQPVSGVDSVEAEALPHDNRAQSIADFGKAALDTYVMLSPARRENADPAFLKAHLP
DYWYPAIARHTGKSMAAAASEAGGNQNYLYASRQITFYSDQIREPDVPRILDNAFLMSSSRNYIDSLRAQ
SLRSIETITLESDTLFAFGRADFQSLKSEGQRQLSAIASKLLNTPDIGKIIISGHADQLGDSQGNLQVSK
QRAQTIRTYLVGKGVPAELVVAQGEGSRKPLVNCDLQQPRAQLIKCLEPNRRVEIEVRGLN
 
Nucleotide Sequence: 2496 bp     [Download]
>gi|568185322|ref|NC_023076.1|:2783757-2786252 Pseudomonas monteilii SB3101, complete genome
ATGAACAAGATCAAGTACTACTGCCTGCGCTACCAACCCTACCTGCTGGGAGTGGCGTTCTTCCTGGCGA
TCTTCCTGGTCTGGGCCATCGGCTGCGCCCTGGGCTTCGCCTCGCTGCATAGCCTGCTGGCCGGTATCGG
CGTGTTTCTGCTGCTGTCGGCAGGCTATGTACTGCTGCTTTATCGCGGCGCCGGCCAGCACCACAACCTC
GAAGGGTTACTGCGCGACGATGCCGACCAGGCGGTACTCAACGCCACCCCCGCCGACCGCGAAGAAGTAA
GCCTGCTGCGCGAACGCCTGCTGCAGAGCATCGAGCGCCTGCGCAGTAACACACCTCGCGGCACCTCGGC
CAAGGACGCGCTGTACGCCCTGCCCTGGTACCTGGTGATCGGTCAGCCGGCTGCCGGCAAGAGCACGATG
ATCCTGCAGTCGGGCCTGAACTTCCCCTATGCCGAACGCGAAGGCGCACGGGTTGCGGGGCTTGGCGGCA
CGCGCAACTGCGACTGGTTCTTCAGCTCCGAAGCCGTGCTGCTGGATACCGCCGGGCGCTACATGAACAG
CCCCGAAGAAGCCGGCAAGTGGCGCGGCTTCCTGCAGCTGTTGCGCCAGCATCGCCAACGCCGCCCTCTC
AACGGCTTGATCGTCAGCGTCAGCATCGCCGACATCCTGCATGGCTCGGCCGAGGACCAGGACCGCGTGG
CCAAGCGCCTGCGTGAACGGATCCAGGAAAGCTGCGCGCTGCTGGAAGTGCGCCTGCCGATCTACCTGGT
GTTCACCAAGTGCGACCTGATTCCCGGCTTCACCCCGTTCTATCGCCAGCTTGACGACGCCGCGCGTGGC
GAGGTGATGGGCAAGACCTTCTCGCACAAGGGTTACGAACAGGCCGACTGGGGCCAGCGTTTCGGCAAGG
CGATGGACGAGCTGACCGGTTACTGGCAGCAGGTGGCGAACCAGCAACTGGTGCAGCAAGATATTCAGGT
AACCCGGCAGAACAATGCGGCCTATCGCTTCCCGCTGGAGCTGGCCGCACTCAAGCCGCGCCTGCAACAA
TTCGTCGACAGCCTGCTGCGCGCCAACCCGTACCAGAACGCCGAAATGCTGCGCGGTTTCTATTTCACTG
CCGCACTGCAGGCCGATGAAGCCCTGTGGGGCAGCCACGGCCAGCATGTGGCCGAACGCTTCGCCCTCGA
ACATGCCGAAGGCACCGCCACTGCCGTCAGCCAGCCGGCGCCGCTGTTCATCAACAGCCTGTTCCGCAAG
GTGATCATCCCCGACCAGCACCTGGTGGCGCTGTACACCAGCAACACGCGGGAGCGCCGGCGCAAGGCGG
GCTGGGTTGCCGCCACCGGCCTGGCAGCCCTGGTGCTGTGCAGCCTGTGGGGCTGGTCGTACCTGAACAA
CCGCGCCATCCTGGCCAACATCGCCGGCGAACTGGCCCAGGCCAAGGCCGACGACCAGGCTGCCCGCGGC
CAGTACGCCGCCTGGCATAGCCTTGATCGCTTGCGCTTCTGGGCCGAGCACTACTATCGGCAGCACCGCG
AACAGGGCGTGCCGCTGGGCATGCGCCTGGGCCTGTACCAGGGCCATGAGGTCGAGCCGCTGCTGCGCAG
CCGTTACTTCGCCACGCTGCAGAACGTGATGCTCAAGCCCACGGCAGACAACCTGACCCGCACCCTGTAC
CTGCTGACCACGATCAAGGTGTACCAGCGCAACACCCGCGAACTGCAGCCTGTGAGCGGCGTGGACAGCG
TCGAGGCCGAGGCGCTGCCACATGACAACCGCGCGCAGTCGATCGCCGACTTCGGCAAGGCGGCGCTGGA
TACCTACGTGATGCTCTCGCCGGCCCGACGCGAAAACGCCGACCCGGCGTTTCTCAAGGCGCACCTGCCC
GACTACTGGTACCCGGCCATCGCTCGCCATACCGGCAAGAGCATGGCCGCGGCCGCCAGCGAGGCTGGCG
GCAACCAGAACTATCTGTACGCCAGCCGCCAGATCACCTTCTACAGCGACCAGATTCGTGAGCCGGATGT
GCCGCGTATCCTCGACAACGCCTTCCTGATGTCCAGTTCGCGCAATTACATCGACAGCCTGCGCGCCCAG
TCGCTGCGTTCGATCGAGACCATCACGCTGGAGTCCGACACCCTGTTCGCTTTCGGCCGGGCCGACTTCC
AGAGCCTGAAGAGCGAGGGCCAGCGCCAGCTGAGCGCGATCGCCAGCAAACTGCTGAACACGCCCGACAT
CGGCAAGATCATCATTTCCGGCCACGCCGACCAGCTCGGCGACAGCCAAGGCAACCTGCAGGTTTCGAAA
CAGCGGGCGCAGACCATTCGCACCTACCTGGTCGGCAAGGGCGTACCTGCCGAACTGGTGGTCGCCCAGG
GCGAAGGCAGCCGCAAGCCGCTGGTCAACTGCGACCTGCAGCAACCGCGAGCGCAACTGATCAAGTGCCT
GGAGCCCAACCGCCGGGTGGAAATCGAAGTACGCGGGCTCAACTGA
 Primer design