SecReT6
Protein ID: 568288011
SecReT6 ID892
T6SS typei3
Gene symbol-
Locus tagMETH_23370
StrainLeisingera methylohalidivorans DSM 14336 strain MB2, DSM 14336
Repliconplasmid [GenBank: NC_023136] [Browse all T6SS(s) in this replicon]
Location [Strand]228758..229330 [+]
Productflagellar motor protein MotB
NoteTagL
UniProt IDV9VYM1
KEGG IDlmd:METH_23370
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 2.60E-17, Aligned region: 35..46
OmpA [PF00691], Evalue: 2.60E-17, Aligned region: 88..182
Protein Sequence: 190 a.a.     [Download]
>gi|568288011|ref|YP_008973995.1| flagellar motor protein MotB [Leisingera methylohalidivorans DSM 14336]
MIRLKGIFASVLGAGLIFAPPTLAQSDGGELSVEEITEAFKKQKTRGLVIVPSSAAAAEDPAEETATVAA
AEEYNPVDRQTQINVQISFDFDSAALRADQAPKLANMCASMKALDGTVFQIIGHTDSSGSAAYNERLSLL
RAQEVRRHLISSCGVSEDMLKAIGMGETAPFNENNTRADENRRVEFQALG
 
Nucleotide Sequence: 573 bp     [Download]
>gi|568287774|ref|NC_023136.1|:228758-229330 Leisingera methylohalidivorans DSM 14336 strain MB2, DSM 14336 plasmid unnamed, complete sequence
ATGATCCGCCTTAAAGGAATTTTTGCAAGTGTTCTGGGTGCGGGCTTGATTTTCGCTCCGCCAACTCTGG
CGCAGTCGGATGGCGGCGAATTGTCGGTCGAGGAAATCACCGAAGCTTTCAAGAAGCAGAAGACCCGCGG
CCTGGTGATCGTGCCAAGCAGCGCAGCTGCGGCTGAGGATCCTGCGGAGGAAACCGCAACCGTGGCCGCC
GCCGAGGAATACAATCCTGTCGACCGGCAGACCCAGATCAATGTCCAGATCTCCTTCGATTTCGACAGCG
CCGCGCTGCGCGCCGATCAGGCGCCGAAACTGGCCAATATGTGCGCGTCGATGAAGGCGCTCGATGGCAC
CGTGTTCCAGATCATCGGCCATACCGACAGCTCTGGATCCGCCGCCTATAATGAACGGCTGTCACTGTTG
CGGGCGCAGGAAGTACGCCGCCACCTGATCAGCTCCTGCGGTGTGAGCGAGGATATGCTCAAAGCCATCG
GCATGGGTGAAACCGCACCCTTCAACGAAAACAATACGCGCGCCGATGAAAACCGCCGTGTTGAATTCCA
GGCTCTGGGCTGA
 Primer design