SecReT6
Protein ID: 568288015
SecReT6 ID892
T6SS typei3
Gene symbol-
Locus tagMETH_23390
StrainLeisingera methylohalidivorans DSM 14336 strain MB2, DSM 14336
Repliconplasmid [GenBank: NC_023136] [Browse all T6SS(s) in this replicon]
Location [Strand]233027..236599 [-]
Producttype VI secretion protein
NoteTssM
UniProt IDV9W2B8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.60E-96, Aligned region: 191..455
IcmF-related [PF06761], Evalue: 7.50E-95, Aligned region: 506..812
DUF1215 [PF06744], Evalue: 8.10E-40, Aligned region: 927..1050
Protein Sequence: 1190 a.a.     [Download]
>gi|568288015|ref|YP_008973999.1| type VI secretion protein [Leisingera methylohalidivorans DSM 14336]
MIRRYIFPLFRSIYTILLVLAAVLSACVWFFAPFIGGVEWRPFDSVMSRLITIGVIFLLYFIIIAIIFWR
RRRKDKEMTEEIAEAVDTSEDDVLSEEIGELRGKFKDAMKELRKSKGGRRHLNDLPWYIMIGPPGAGKTT
AIVNSGLQFPLAEKLGKAAIGGVGGTRNCDWWFTNDAVLIDTAGRYTTQESDAEADNAAWLGFLGLMKKY
RKRQPINGAIIAISLSDLSLQDEITQKSHAAAVRRRLAELREKLGVRFPVYVLFTKADLIAGFQEFHDSL
GKEDREQVWGFTLPLPKGKKDAAPIAGFDEEFGLLLGQINAQLLEKMQTETDHQRRALIAGFPAQVASMR
GVARDFLTEVFQDNRYEQRQMLRGIYFTSGTQEGTPIDRLMLGMAQTFGIGRQAIGTGQGTGRSFFLTRL
FESVMFPEAGLVSADDKVERRYRWTRRIAITATVLVAVAMGALWVRSYLKNTDLIAQAEGQVAAYQAAAA
QLPPSPVGDTDLVPVAAALNNLRDMPGNPVLSDPEPDGAMTYGLYQGEVIGTQAAQTYRAALNQRLLPRL
LVRLEQQIEGNINNPDTLYEALKIYLMLGLQGPMNQDLVKEWMRLDWERIAYPGIARNQLRADLMDHLTA
LLSQPMEEIALNGPLIAQAQNILSEMPLAQRVYNGILNSQKATSLPKWRITDVGGPSVKRVLVRSSGKPL
NEGIEGIFTYDGFHNVFLPEAVSVAERVHREAWVLGEQNEAAQNKAVLLKLSRDVLDLYYNDYISRYDQI
LGDIDIIPLESLSHAVEVTNVLSGPTSPVINILTDVSNETRLNEDKSLLDASTLAAGAQNVAAIEARSNL
SIQGQILLEALVGSAENAPGQAAKPPGAYVQERFQWLHDLVDRPEGQPSQLDDLMGQLQQVYQELNKMSF
SGVATGGQSGQALLQFQQTASRMGGPLPRWATQISAGSSGITSEGTRASINARWQSAVLPFCEKALANRY
PFNRSARADVAMADFAKLFAPGGMIDGFFNDQLLKYVDTRSRPWTWKRVNDVDLGISPAVLQQMQYAAEI
KEAFFAGGAQPAVQFQITVNALDPKAKEVVLEIDGTKVAYNHRSGAPTPVAVTWPGSVGLARITLLPKKR
DAENAMSRDGPWAWFRLLDAAEVRRTNVSDRRRVNFRVGGRLALFELQSGSVINPFALPAMAKFSCPKSM
 
Nucleotide Sequence: 3573 bp     [Download]
>gi|568287774|ref|NC_023136.1|:c236599-233027 Leisingera methylohalidivorans DSM 14336 strain MB2, DSM 14336 plasmid unnamed, complete sequence
ATGATCCGCCGTTATATCTTTCCCCTGTTCCGGTCGATCTACACCATCCTGCTGGTCCTGGCAGCGGTGC
TGTCGGCCTGTGTATGGTTTTTCGCGCCGTTCATCGGCGGCGTCGAGTGGCGCCCGTTTGACAGCGTGAT
GTCGCGGCTGATCACCATCGGGGTGATCTTCCTGCTGTATTTCATCATCATCGCCATCATCTTCTGGCGG
CGGCGCCGCAAGGACAAGGAGATGACCGAGGAGATCGCCGAGGCGGTGGACACATCGGAAGATGATGTGC
TGTCCGAGGAAATCGGCGAGCTGCGCGGCAAGTTCAAGGACGCGATGAAGGAGCTGCGCAAGTCCAAGGG
CGGGCGGCGTCACCTGAACGATCTGCCGTGGTACATCATGATCGGCCCGCCGGGCGCGGGCAAGACAACG
GCGATTGTCAATTCCGGCCTGCAGTTCCCGCTGGCCGAGAAGCTGGGCAAGGCCGCGATCGGCGGCGTCG
GCGGCACCCGCAACTGCGACTGGTGGTTCACCAATGACGCGGTGCTGATCGACACGGCGGGGCGTTACAC
CACCCAGGAAAGCGACGCCGAGGCGGACAATGCCGCCTGGCTGGGCTTCCTGGGGCTGATGAAGAAATAC
CGCAAGCGGCAGCCGATCAACGGTGCGATCATTGCGATTTCATTGTCGGACCTGTCGCTGCAGGATGAGA
TTACCCAGAAAAGCCACGCTGCCGCCGTGCGCCGCCGCCTGGCGGAGCTGCGCGAAAAGCTGGGCGTGCG
TTTCCCGGTCTATGTGCTGTTCACCAAGGCGGATCTGATTGCCGGCTTCCAGGAGTTCCATGACAGCCTT
GGCAAGGAAGACCGCGAGCAGGTCTGGGGTTTCACGCTGCCGTTGCCCAAAGGTAAAAAGGACGCCGCGC
CGATTGCCGGGTTTGACGAGGAGTTCGGTCTGCTTCTGGGGCAGATCAATGCGCAGCTTTTGGAGAAGAT
GCAGACCGAGACCGACCATCAGCGGCGGGCGCTGATAGCTGGTTTTCCGGCGCAGGTCGCCTCGATGCGC
GGGGTGGCGCGCGATTTTCTGACGGAGGTGTTCCAGGACAACCGCTATGAGCAGCGCCAGATGCTTCGGG
GGATTTACTTCACCTCCGGCACCCAGGAAGGCACGCCGATCGACCGTCTGATGCTGGGAATGGCGCAGAC
TTTCGGCATCGGGCGGCAGGCGATTGGCACCGGGCAGGGCACCGGGCGGTCATTTTTCCTGACCCGGCTG
TTTGAGAGTGTGATGTTCCCTGAGGCCGGACTGGTGTCGGCGGATGACAAAGTGGAACGGCGCTACCGCT
GGACCCGCCGGATTGCGATCACCGCGACTGTGCTGGTGGCAGTTGCAATGGGTGCGCTTTGGGTGCGCTC
TTATCTGAAGAACACCGATCTGATTGCCCAGGCCGAGGGCCAGGTCGCCGCCTATCAGGCCGCCGCGGCG
CAATTGCCGCCCAGCCCGGTTGGCGATACTGACCTGGTGCCGGTGGCCGCTGCGCTGAACAATCTGCGCG
ACATGCCGGGCAATCCGGTGCTGTCGGATCCGGAGCCCGACGGGGCGATGACCTATGGCCTGTATCAGGG
CGAAGTGATCGGCACCCAGGCTGCGCAAACCTATCGCGCGGCGCTGAACCAGCGGCTGCTGCCGCGGCTG
CTGGTGCGGCTGGAGCAGCAGATCGAAGGCAATATCAACAATCCCGACACGCTGTATGAGGCGCTGAAGA
TTTATCTGATGCTGGGCCTGCAGGGGCCGATGAACCAGGATCTGGTCAAGGAATGGATGCGGCTGGACTG
GGAGCGGATCGCCTATCCCGGCATCGCCCGCAACCAGCTGCGCGCGGATCTGATGGACCATCTGACCGCG
CTTTTGTCACAGCCGATGGAGGAGATTGCCCTTAACGGCCCGCTGATTGCCCAGGCGCAGAACATCCTGT
CGGAAATGCCGCTGGCGCAGCGCGTCTATAACGGCATCCTGAACTCTCAAAAAGCCACCAGCCTGCCGAA
ATGGCGGATCACCGACGTTGGCGGACCGTCTGTCAAGCGGGTGCTGGTGCGCAGTTCCGGCAAGCCGCTG
AACGAGGGGATCGAGGGTATCTTTACCTATGACGGTTTCCACAATGTGTTCCTGCCGGAGGCTGTCAGCG
TGGCCGAACGGGTGCACCGTGAAGCCTGGGTGCTGGGTGAGCAAAACGAAGCGGCCCAGAACAAGGCCGT
GCTGCTGAAGCTGAGCCGCGACGTTCTGGACCTGTATTACAACGATTACATCAGCCGCTATGACCAGATC
CTGGGCGATATCGACATCATCCCGCTGGAGTCGCTGTCCCACGCTGTGGAGGTGACCAATGTGCTGTCCG
GGCCGACTTCGCCGGTCATCAATATTCTGACCGACGTCAGTAACGAGACCCGGCTGAATGAGGACAAATC
GCTTCTGGACGCGAGCACTCTTGCCGCGGGCGCCCAGAACGTGGCCGCGATTGAGGCGCGATCCAACCTG
TCGATCCAGGGGCAGATCCTGCTGGAGGCGCTGGTCGGATCTGCCGAAAATGCGCCAGGCCAGGCGGCCA
AGCCGCCGGGGGCCTATGTGCAGGAGCGGTTTCAGTGGCTGCATGACCTTGTCGACCGGCCCGAAGGCCA
GCCGTCGCAGCTGGATGATCTGATGGGGCAGCTGCAGCAGGTCTATCAGGAGCTGAACAAAATGTCCTTC
TCCGGCGTCGCCACCGGCGGTCAGAGCGGCCAGGCGCTGCTGCAGTTCCAGCAGACCGCCAGCCGGATGG
GCGGGCCGCTGCCCCGCTGGGCGACGCAGATCTCGGCCGGCTCCTCGGGGATCACCTCGGAAGGGACCAG
GGCGTCGATCAATGCGCGCTGGCAATCGGCGGTGCTGCCGTTCTGTGAAAAGGCGCTGGCCAACCGCTAC
CCGTTCAACCGTTCGGCGCGGGCCGATGTGGCAATGGCGGATTTTGCCAAGCTGTTTGCGCCCGGCGGCA
TGATTGACGGCTTTTTCAACGACCAGCTGCTGAAATACGTCGATACCCGCAGCCGTCCCTGGACCTGGAA
ACGGGTGAATGACGTGGATCTGGGCATCAGCCCGGCGGTGCTGCAGCAGATGCAGTATGCCGCCGAGATC
AAGGAAGCGTTCTTTGCCGGCGGGGCCCAGCCCGCGGTGCAGTTTCAGATCACCGTCAATGCGCTGGACC
CGAAGGCAAAGGAAGTGGTGCTGGAGATCGATGGCACCAAAGTGGCCTATAATCACCGGTCCGGCGCGCC
GACGCCTGTGGCCGTGACTTGGCCGGGGTCGGTCGGGCTGGCGCGGATCACCCTCTTGCCCAAGAAGCGC
GACGCCGAGAATGCGATGTCACGCGATGGCCCCTGGGCCTGGTTCCGGCTGCTGGATGCGGCTGAGGTGC
GGCGCACCAATGTCTCTGACCGGCGGCGGGTGAACTTCCGTGTTGGCGGGCGTCTGGCGCTGTTCGAGCT
GCAGTCCGGGTCGGTCATCAATCCCTTCGCCCTGCCGGCAATGGCAAAATTCAGCTGTCCGAAGTCGATG
TAA
 Primer design