SecReT6
Protein ID: 568288016
SecReT6 ID892
T6SS typei3
Gene symbol-
Locus tagMETH_23395
StrainLeisingera methylohalidivorans DSM 14336 strain MB2, DSM 14336
Repliconplasmid [GenBank: NC_023136] [Browse all T6SS(s) in this replicon]
Location [Strand]236596..238029 [-]
ProductOmpA family protein
NoteTssL
UniProt IDV9VYM7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.40E-67, Aligned region: 86..291
OmpA [PF00691], Evalue: 4.20E-16, Aligned region: 367..465
Protein Sequence: 477 a.a.     [Download]
>gi|568288016|ref|YP_008974000.1| OmpA family protein [Leisingera methylohalidivorans DSM 14336]
MADYDDPFAEPGDTDKTVIKPNPGGRRTATPVQQPETPQVQPGAEQTAAPAETGLDAYGVPQAAAPKPQA
AAGGAKAPKMALTGMNQLTACASTLFALISRIRNRAQHMDPDGLRKNVVAEVRAFENRALQAGIAAQTVK
IARYALCATLDDVVLNTPWGGQSAWGLQSMVATFHREVVGGDRFYDLLARLEKEPGGNIDMLEFLYMCLS
LGFEGRLRVEQGGSEKHMQIRGALARIIRNQRGPVERDLSPHWEGLVKPFKALSVWRLVWITLAATAAVL
ALQFLGLSWMLSNKTENVVGQLTIVDSGPRAELERRAPPPPPPPTAPTTEEQIAKVTGFLEPEIKEGIVQ
VFQKGNTLIIRLAGSGMFGSGSDQLSQKFRTSVNRVAESLNDEKGKIIVAGHSDNIPIRSSRFPSNMALS
LARAKSVMAGMAKVMTDPDRLSAEGRADKEPIADNSTRAGRAKNRRIEILLVQEVEG
 
Nucleotide Sequence: 1434 bp     [Download]
>gi|568287774|ref|NC_023136.1|:c238029-236596 Leisingera methylohalidivorans DSM 14336 strain MB2, DSM 14336 plasmid unnamed, complete sequence
ATGGCTGATTATGACGATCCCTTTGCCGAACCGGGGGATACCGACAAGACGGTGATCAAGCCGAACCCTG
GCGGGCGGCGGACGGCCACGCCGGTGCAGCAGCCGGAGACACCGCAGGTCCAGCCTGGAGCGGAACAGAC
CGCGGCCCCGGCGGAGACGGGGCTGGATGCCTATGGCGTGCCGCAGGCGGCTGCACCGAAGCCGCAGGCT
GCCGCGGGCGGGGCGAAGGCGCCGAAGATGGCGCTGACGGGGATGAACCAGCTGACGGCCTGTGCCTCGA
CCCTGTTTGCGCTGATCAGCCGGATCCGCAACCGGGCCCAGCACATGGACCCGGATGGTTTGCGCAAGAA
TGTGGTGGCCGAGGTGCGGGCGTTTGAAAACCGCGCGCTGCAGGCGGGCATTGCTGCGCAGACCGTGAAG
ATCGCGCGTTATGCGCTGTGCGCGACACTGGATGACGTGGTCCTGAACACGCCCTGGGGCGGGCAATCCG
CCTGGGGGCTGCAGTCGATGGTCGCGACCTTCCACCGCGAGGTGGTTGGCGGCGACCGGTTTTATGACCT
GCTGGCGCGGCTGGAAAAGGAGCCGGGCGGCAACATCGATATGCTCGAATTCCTGTACATGTGCCTGTCG
CTGGGGTTTGAGGGCCGTTTGCGGGTGGAGCAGGGCGGTTCCGAGAAACATATGCAGATCCGCGGCGCAT
TGGCCCGGATCATCCGCAATCAGCGCGGCCCGGTGGAGCGCGATCTGTCGCCGCATTGGGAAGGCCTGGT
CAAACCGTTCAAGGCGCTGTCTGTCTGGCGGCTGGTGTGGATCACCCTGGCAGCCACCGCGGCGGTGCTG
GCGTTGCAGTTCCTGGGTCTCAGCTGGATGCTGTCGAACAAGACCGAGAATGTGGTCGGGCAGCTGACGA
TTGTCGATTCCGGCCCCAGGGCTGAGCTGGAACGGCGCGCGCCGCCGCCGCCGCCGCCGCCAACCGCGCC
TACGACCGAAGAACAAATCGCCAAGGTCACCGGTTTCCTGGAGCCGGAGATCAAGGAAGGCATCGTGCAG
GTCTTCCAGAAGGGCAACACGCTGATTATCCGGCTGGCCGGTTCAGGCATGTTCGGTTCCGGCTCGGACC
AGCTCAGCCAGAAATTCCGGACCTCGGTGAACCGGGTGGCAGAATCTCTGAATGACGAAAAGGGCAAGAT
CATCGTGGCGGGCCATTCTGACAATATTCCCATCCGCTCGTCCCGCTTCCCGTCCAATATGGCGCTGTCG
CTGGCGCGTGCGAAATCGGTGATGGCAGGGATGGCCAAGGTGATGACCGATCCGGACCGGCTGTCGGCCG
AGGGGCGCGCCGACAAGGAACCGATTGCAGACAACAGCACCCGCGCAGGGCGGGCCAAGAACCGCAGGAT
CGAAATCTTGCTGGTTCAGGAGGTTGAAGGATGA
 Primer design