SecReT6
Protein ID: 568288017
SecReT6 ID892
T6SS typei3
Gene symbol-
Locus tagMETH_23400
StrainLeisingera methylohalidivorans DSM 14336 strain MB2, DSM 14336
Repliconplasmid [GenBank: NC_023136] [Browse all T6SS(s) in this replicon]
Location [Strand]238044..239342 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDV9W3R7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.20E-156, Aligned region: 5..430
Protein Sequence: 432 a.a.     [Download]
>gi|568288017|ref|YP_008974001.1| type VI secretion protein [Leisingera methylohalidivorans DSM 14336]
MQPHHFQQSDRYTEALVAGLARRLSPYAWGVNGLEIDHEALKIGQFAVKSCEGLTHDGTVFRVPMVDPHP
PAMEVPSTIKDCIVYMTVPQRRQGATEVDLSGAERSASRLRPDKQEVTDVTSTERKPVELDVGKMRLQFA
LEVDDLADLLAIPVARIIEVRPDKEIVLDQAFVPACLDVRAAPALSGFLRELEGLLAHRMEALAGRLSEA
GGARGVADVSDFMLLAVVNRMLPQVRHLRNIENLHPERLFTACAGLAGELSVFMSTEKQAPEFPPYTHDN
LVECFAPVIRVLRQYLSSVLEQTAIPIKLEARKYGISVGVIADRKLLGNAGFVLAVSADIPAEDVRKHFS
GQAKIGPVEEIRQLVNSALPGITLRPLPVAPRQIPYHSGVVYFEMDADSPYWRKMTTSGGIAVHVSGQYP
GLKMELWAIRNA
 
Nucleotide Sequence: 1299 bp     [Download]
>gi|568287774|ref|NC_023136.1|:c239342-238044 Leisingera methylohalidivorans DSM 14336 strain MB2, DSM 14336 plasmid unnamed, complete sequence
TTGCAGCCGCATCACTTCCAGCAGTCCGACCGGTATACCGAGGCACTGGTTGCCGGGCTGGCGCGGCGGC
TCAGCCCTTATGCCTGGGGCGTGAACGGGCTGGAGATCGACCATGAGGCGCTGAAAATCGGCCAGTTCGC
GGTGAAGTCCTGCGAAGGGCTGACCCATGACGGCACGGTGTTCCGGGTGCCGATGGTGGATCCGCATCCG
CCGGCGATGGAGGTGCCGTCGACGATCAAGGATTGCATCGTCTACATGACCGTGCCGCAGCGCCGCCAGG
GCGCTACCGAAGTGGATCTGAGCGGCGCCGAACGTTCCGCCAGCCGGTTGCGCCCGGACAAGCAGGAAGT
GACCGATGTGACCTCGACTGAGCGCAAGCCGGTGGAGCTGGATGTGGGCAAGATGCGCCTGCAGTTCGCG
CTGGAGGTGGATGACCTGGCCGATCTGCTGGCGATCCCCGTGGCGCGCATCATCGAGGTGCGCCCGGACA
AGGAGATCGTGCTGGACCAGGCCTTTGTCCCGGCTTGCCTGGATGTGCGGGCAGCGCCTGCGCTTAGCGG
TTTCCTGCGCGAGCTGGAGGGGCTGCTGGCGCACCGGATGGAAGCGCTGGCAGGCCGCTTGTCAGAGGCG
GGCGGCGCCCGCGGGGTGGCGGATGTGTCGGATTTCATGCTGCTGGCCGTGGTCAACCGGATGCTGCCGC
AGGTGCGCCACCTGCGCAATATCGAGAATCTGCACCCCGAACGCCTGTTCACTGCCTGTGCCGGGCTGGC
CGGGGAACTGTCGGTGTTCATGTCGACCGAAAAACAGGCGCCGGAATTTCCACCCTATACCCATGACAAC
CTGGTCGAGTGCTTTGCCCCGGTGATCCGGGTACTGCGGCAGTACCTCAGCTCGGTGCTGGAGCAGACCG
CGATCCCGATCAAGCTGGAGGCGCGCAAATACGGCATCTCGGTCGGGGTGATTGCCGACCGCAAACTGCT
GGGAAATGCTGGTTTCGTGCTGGCAGTCAGTGCCGACATCCCGGCCGAGGACGTGCGCAAGCATTTCTCG
GGCCAGGCCAAAATCGGCCCGGTGGAGGAAATCCGCCAGCTGGTGAATTCAGCCCTGCCGGGGATCACGC
TGCGGCCCTTGCCAGTGGCACCGCGGCAGATCCCCTATCATTCCGGCGTGGTCTACTTCGAGATGGATGC
GGACAGCCCCTATTGGCGCAAGATGACGACCTCGGGCGGCATCGCGGTGCATGTGTCGGGCCAGTATCCG
GGGCTTAAGATGGAGCTTTGGGCGATCCGTAATGCATAA
 Primer design