SecReT6
Protein ID: 568288018
SecReT6 ID892
T6SS typei3
Gene symbol-
Locus tagMETH_23405
StrainLeisingera methylohalidivorans DSM 14336 strain MB2, DSM 14336
Repliconplasmid [GenBank: NC_023136] [Browse all T6SS(s) in this replicon]
Location [Strand]239432..240907 [-]
Productsignal peptide protein
NoteFha
UniProt IDV9W0Z9
KEGG IDlmd:METH_23405
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 2.80E-16, Aligned region: 28..95
Protein Sequence: 491 a.a.     [Download]
>gi|568288018|ref|YP_008974002.1| signal peptide protein [Leisingera methylohalidivorans DSM 14336]
MGVTLKFQSSGAMPGDAAPVPMRGPSLTVGRGASCDLVLPDPDQQLSRNHCVIEDHNGNVVVVDLSSNGT
FLNYSKIPLGRTPTPLNNGDVLCVGNYELVVEIRDDLADIGGMIAAPAAQGAASHGNAANAPDPLQLLED
AGPGGDFLDDLLGEGLKGPAQLNPVDPIDELLPPLGEEEDPFFQKSSDGREGEGASFANHNPTASDGFAV
PAAQSSMIPDDWDDDFLSGIGEPETPAPDPDPQPVPPPREIPSPVPETPPAAPPPEVPPAPPTEIPPVQD
TAAGDAKTIAPAAAPPAQAQDAVAAFLKGAGAEVSLDPADHASTMARMGRVMRTLVTGLREILMTRTSIK
SEFRIEQTMISAGGNNPLKFSITPEQAVEAMVRPATKGYLSPESAAEEALRDIKAHEVAMVTGMEAALKG
VLKRLDPKALEGQIETKGGLKGLLRGKKAQYWDVYEQLYAEISDQAENDFHDLFSREFARAYKDQLDRLK
D
 
Nucleotide Sequence: 1476 bp     [Download]
>gi|568287774|ref|NC_023136.1|:c240907-239432 Leisingera methylohalidivorans DSM 14336 strain MB2, DSM 14336 plasmid unnamed, complete sequence
ATGGGAGTGACGCTGAAATTTCAGAGCTCGGGCGCGATGCCCGGCGATGCAGCCCCTGTTCCGATGCGGG
GGCCGAGCCTGACAGTGGGGCGCGGCGCCAGCTGCGATCTGGTGCTGCCGGACCCCGATCAGCAGCTGTC
GCGCAATCATTGCGTGATCGAGGATCACAACGGCAATGTGGTGGTGGTCGATCTCAGCTCGAACGGGACC
TTTCTGAACTATTCCAAGATCCCGCTTGGCCGTACGCCGACGCCGCTTAACAACGGGGATGTGCTGTGCG
TCGGCAACTATGAGCTGGTGGTGGAAATCCGTGACGATCTGGCGGATATCGGCGGTATGATTGCAGCACC
CGCCGCGCAGGGGGCGGCCTCGCACGGCAATGCCGCCAATGCGCCGGATCCGTTGCAGCTGCTGGAAGAT
GCCGGGCCGGGCGGCGACTTCCTGGACGATCTGCTGGGCGAGGGGCTGAAGGGGCCTGCACAGCTGAACC
CGGTGGATCCGATTGATGAGCTGCTGCCGCCCCTGGGTGAGGAAGAAGATCCTTTCTTTCAAAAATCTAG
CGACGGGCGTGAGGGGGAGGGGGCGAGCTTTGCCAACCACAACCCGACCGCTTCGGACGGGTTTGCAGTG
CCCGCAGCGCAGTCCAGTATGATCCCGGACGACTGGGACGATGATTTCCTGTCCGGTATAGGCGAGCCGG
AAACCCCGGCGCCTGACCCCGACCCGCAACCCGTGCCGCCGCCGCGCGAGATTCCGTCTCCGGTGCCGGA
AACCCCGCCTGCAGCACCACCGCCGGAAGTGCCGCCTGCACCGCCGACCGAGATACCGCCGGTGCAGGAT
ACGGCTGCAGGGGATGCGAAAACCATTGCACCGGCGGCAGCGCCCCCGGCGCAGGCGCAGGACGCGGTGG
CCGCTTTCCTGAAGGGCGCAGGCGCCGAAGTCAGCCTTGATCCGGCGGACCACGCCAGCACCATGGCGCG
CATGGGCCGGGTGATGCGGACATTGGTCACCGGCCTGCGCGAAATCCTGATGACGCGGACCTCGATCAAG
TCGGAATTCCGGATCGAGCAGACGATGATCTCGGCTGGCGGAAACAATCCGCTGAAATTCTCGATCACGC
CTGAACAGGCGGTTGAAGCGATGGTCCGCCCGGCGACCAAAGGCTACCTGAGCCCGGAATCCGCTGCCGA
AGAAGCGCTGCGCGACATCAAGGCGCATGAAGTGGCGATGGTCACCGGCATGGAGGCGGCGCTGAAAGGC
GTGCTGAAACGGCTCGACCCCAAGGCGCTGGAAGGCCAGATCGAAACCAAAGGCGGCCTAAAGGGTCTTT
TGCGTGGCAAAAAGGCGCAATACTGGGACGTCTATGAACAGCTTTATGCGGAGATTTCCGACCAGGCTGA
GAATGATTTTCACGACTTGTTCAGCCGCGAGTTCGCGCGTGCCTACAAGGATCAGCTGGACAGGCTGAAG
GACTGA
 Primer design