SecReT6
Protein ID: 568288019
SecReT6 ID892
T6SS typei3
Gene symbol-
Locus tagMETH_23410
StrainLeisingera methylohalidivorans DSM 14336 strain MB2, DSM 14336
Repliconplasmid [GenBank: NC_023136] [Browse all T6SS(s) in this replicon]
Location [Strand]240916..241218 [-]
Producthypothetical protein
NotePAAR
UniProt IDV9W1G1
KEGG IDlmd:METH_23410
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.60E-21, Aligned region: 1..54
PAAR_motif [PF05488], Evalue: 1.60E-21, Aligned region: 29..91
Protein Sequence: 100 a.a.     [Download]
>gi|568288019|ref|YP_008974003.1| hypothetical protein METH_23410 [Leisingera methylohalidivorans DSM 14336]
MGMPQARMTDLHACMLPSTPPPPVLPVPTPILPPCAVTVLVANLPAARLGDMCTAAPAPHPIIKGSATVL
INNMPAARILDNTACGGMVVKGEFTVLVGG
 
Nucleotide Sequence: 303 bp     [Download]
>gi|568287774|ref|NC_023136.1|:c241218-240916 Leisingera methylohalidivorans DSM 14336 strain MB2, DSM 14336 plasmid unnamed, complete sequence
ATGGGAATGCCACAGGCCCGGATGACGGATTTGCATGCCTGCATGCTGCCCTCAACCCCGCCGCCGCCGG
TTCTGCCGGTGCCGACGCCGATCCTGCCGCCCTGCGCGGTGACAGTGCTGGTGGCGAACCTGCCGGCCGC
CCGTCTTGGGGATATGTGCACCGCCGCGCCCGCGCCGCATCCGATCATCAAAGGCTCTGCCACGGTGCTG
ATCAACAACATGCCGGCCGCGCGGATCCTGGACAACACCGCCTGCGGCGGCATGGTCGTCAAGGGTGAAT
TCACCGTGCTGGTGGGAGGTTAG
 Primer design