SecReT6
Protein ID: 568288021
SecReT6 ID892
T6SS typei3
Gene symbol-
Locus tagMETH_23420
StrainLeisingera methylohalidivorans DSM 14336 strain MB2, DSM 14336
Repliconplasmid [GenBank: NC_023136] [Browse all T6SS(s) in this replicon]
Location [Strand]241852..243963 [-]
Producttype VI secretion protein
NoteTssI
UniProt IDV9VYN4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.40E-71, Aligned region: 31..334
Phage_base_V [PF04717], Evalue: 2.60E-21, Aligned region: 403..496
DUF2345 [PF10106], Evalue: 2.50E-05, Aligned region: 614..668
Gp5_C [PF06715], Evalue: 0.0022, Aligned region: 548..554
Gp5_C [PF06715], Evalue: 0.0022, Aligned region: 578..589
Gp5_C [PF06715], Evalue: 0.0022, Aligned region: 601..626
Gp5_C [PF06715], Evalue: 0.0022, Aligned region: 628..635
Protein Sequence: 703 a.a.     [Download]
>gi|568288021|ref|YP_008974005.1| type VI secretion protein [Leisingera methylohalidivorans DSM 14336]
MVVSKGHENDLAWMSGTYSTDGLQMSRAIVREGLSKLTETTIEFAATKSQPKLQDLVGKQMNVHVMRQQT
EHQFNGLCVSVEYLGFRNGYEMYVAEVRPWFWLLTRTSDLRVFQEKTSVDIIKQLFSEHGFSDFTDKLSD
SYEAREYCLQYRESDYAFLCRLMEEEGIYFYFDSPAGDTAREKLVLCDGVSGHSPIKGGAAIEFHARDDS
DRRREEHISEWAKEEILTRGKVTLNDFNFETPSADLTAATAIAKGNHSYKNYEVYDYQGRYPSKTPLGDK
RSRVRMEAEAVRHIRWRGASSVATLGTGSTFTMEKHPVKENNKEYLVIETEHHIKVAWDYGERESQKTEK
VATRGSMRRDLKPKNMDVPEEMEHDVYASTFSAILKSDQFRAPLVTPWPEVPGLQTATVVGQSGEEIWTD
EHGRIKIQFHWDREGKDNETSSCFVRVVTPWSGKNWGMVAIPRMGQEVVIQFEDGNPDRPICTGMLYNAE
TMPPYTYPDDQTQLGIKTNSSKGGGGYNELMFDDKKDSELMRVQAEKDHQMLVKDRSTVTVGMDAPDPEV
TGADEKSYVFTVQQHMTETVHEGDRTEVVETGDKSENIQTGNMTLDVDTGNLTETIAQGNHTETVSLGNL
TVDVTTGKIAMTAGQEIKMTVGPSSIKIDNSGVTISGPMIKIEGSGMVEAKAPMTTVKGEAMLTLKGGLT
MIN
 
Nucleotide Sequence: 2112 bp     [Download]
>gi|568287774|ref|NC_023136.1|:c243963-241852 Leisingera methylohalidivorans DSM 14336 strain MB2, DSM 14336 plasmid unnamed, complete sequence
ATGGTTGTAAGTAAGGGCCATGAAAACGACCTCGCCTGGATGTCGGGGACATATTCCACCGACGGGCTGC
AGATGAGCCGTGCGATTGTGCGCGAGGGGCTGAGCAAGCTGACCGAGACCACGATCGAATTTGCCGCGAC
CAAGAGCCAGCCCAAGCTGCAGGATCTGGTCGGCAAGCAGATGAATGTGCATGTGATGCGCCAGCAGACC
GAGCATCAGTTCAACGGGCTGTGCGTATCAGTCGAGTATCTGGGCTTCCGCAACGGGTATGAGATGTATG
TGGCGGAGGTGCGCCCCTGGTTCTGGCTGCTGACGCGGACCAGCGATCTGCGGGTCTTTCAGGAAAAGAC
CTCTGTCGATATTATCAAGCAGCTGTTCAGCGAGCACGGCTTCAGCGATTTCACCGACAAGCTGAGCGAT
TCCTACGAAGCGCGCGAATATTGCCTGCAGTACCGGGAGAGCGATTATGCCTTTCTGTGCCGGCTGATGG
AGGAAGAGGGGATTTACTTCTACTTCGACAGCCCGGCCGGCGATACTGCGCGGGAGAAGCTGGTGCTGTG
CGATGGGGTCAGCGGGCATTCTCCCATCAAGGGCGGCGCGGCCATTGAATTCCATGCCCGCGACGACAGC
GACCGCCGCCGCGAGGAGCATATCTCGGAATGGGCCAAGGAGGAAATCCTCACCCGCGGCAAGGTCACGC
TGAATGATTTCAACTTTGAGACGCCCTCGGCGGATTTGACGGCGGCCACCGCGATTGCCAAGGGGAACCA
CTCCTACAAGAACTATGAAGTTTACGACTACCAGGGCCGTTATCCGTCCAAGACGCCATTGGGGGACAAG
CGGTCGCGGGTGCGGATGGAAGCGGAGGCGGTCAGGCACATCCGCTGGCGCGGCGCGTCGAGCGTGGCGA
CGCTGGGCACCGGCAGCACTTTCACTATGGAAAAGCACCCGGTGAAGGAGAACAACAAGGAATACCTGGT
CATTGAGACTGAGCACCATATCAAGGTGGCTTGGGATTACGGGGAACGGGAAAGCCAGAAGACGGAAAAG
GTTGCGACCAGGGGGTCCATGCGCCGCGATCTGAAACCGAAGAATATGGATGTGCCCGAGGAGATGGAGC
ATGACGTCTATGCCTCGACCTTCAGCGCGATCCTGAAATCCGATCAGTTCCGGGCGCCGCTGGTGACCCC
CTGGCCGGAAGTGCCGGGGCTGCAGACCGCGACAGTAGTCGGCCAGAGCGGCGAGGAGATCTGGACCGAC
GAGCACGGGCGCATCAAGATCCAGTTTCATTGGGACCGCGAAGGCAAGGACAATGAAACCTCGTCGTGTT
TTGTGCGGGTGGTGACCCCCTGGTCCGGCAAGAACTGGGGCATGGTGGCGATCCCGCGCATGGGGCAGGA
GGTTGTGATCCAGTTCGAGGACGGCAATCCGGACCGGCCGATCTGCACCGGCATGCTTTACAATGCGGAA
ACCATGCCGCCCTATACCTATCCCGACGATCAGACCCAGCTGGGGATCAAGACCAACTCCTCCAAGGGCG
GCGGCGGCTATAACGAGTTGATGTTCGATGACAAGAAGGACAGCGAACTGATGCGGGTTCAGGCCGAGAA
AGATCATCAGATGCTGGTCAAGGACCGCTCGACGGTGACGGTGGGCATGGATGCGCCCGACCCGGAAGTG
ACCGGGGCCGATGAAAAGAGCTATGTGTTCACGGTTCAGCAGCACATGACGGAAACCGTGCATGAGGGCG
ACCGGACCGAGGTGGTGGAAACCGGCGACAAGTCTGAGAATATCCAGACCGGCAACATGACCCTGGACGT
GGACACCGGCAATCTGACCGAAACCATTGCCCAGGGCAACCACACGGAGACTGTGTCGCTGGGCAATCTG
ACCGTGGACGTGACAACGGGCAAGATCGCGATGACCGCGGGCCAGGAGATCAAGATGACGGTGGGGCCTT
CCTCGATCAAGATCGACAACTCCGGCGTCACCATCTCTGGCCCGATGATCAAGATCGAAGGCTCTGGTAT
GGTTGAGGCCAAGGCGCCGATGACCACCGTGAAAGGCGAGGCCATGCTGACCCTGAAGGGCGGCCTCACG
ATGATCAACTAG
 Primer design