SecReT6
Protein ID: 568288022
SecReT6 ID892
T6SS typei3
Gene symbol-
Locus tagMETH_23425
StrainLeisingera methylohalidivorans DSM 14336 strain MB2, DSM 14336
Repliconplasmid [GenBank: NC_023136] [Browse all T6SS(s) in this replicon]
Location [Strand]244028..248992 [-]
Producthypothetical protein
NoteTssC
UniProt IDV9W3S1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 7.10E-74, Aligned region: 1174..1206
DUF877 [PF05943], Evalue: 7.10E-74, Aligned region: 1262..1549
DUF770 [PF05591], Evalue: 1.50E-65, Aligned region: 9..158
DUF770 [PF05591], Evalue: 1.50E-65, Aligned region: 1087..1180
Protein Sequence: 1654 a.a.     [Download]
>gi|568288022|ref|YP_008974006.1| hypothetical protein METH_23425 [Leisingera methylohalidivorans DSM 14336]
MADSSQKFIARNRAPRVQIEYDVELYGAEKKVQLPFVMGVLSDLAGKSTVEQPAVADRKFLEIDVDNFDE
RMKSMAPRAAFTVPNTLTGEGNLAVDLTFKSLADFSPGAIAAKVDALRPLLEARTQLQNLMAYMDGKTGA
ETLIETILNDPSLLAAVSAPPGDSGSAAALESLRSLELPGEEADSSDDVLAGLAAAAPEAAAPADESGGV
LDALRDAAPEDQAAEDASAGVLEGLRGAPPGDAAPEDTSADVLAGLSTAAPANPEPQDIAADALAALAAT
GVPEMTEEDGAASVLEGLAQAAVPESAAEDASGNVLDGLRAAAPAEEDNEDASAEVLAGLSAAEPAEEDQ
GDDAGEALASLAAAEPLDPEEEHGADTVLEGLAQAELPEAEDADTSGDVLAGLAAQEPADAGAEDASGAA
LESLAAVEVAEAELDDHSGVLGALADIDVPEQADTAAEDALEGLAAVETAEQPAEDHSGILDGLAERAPE
DETEDDTAGAALESLAAADAPDADAADETASVLDDLAAVEVDGGGDDTAGAALDSLASVEIAEDGTEDVA
GVLSELSDVAPEAEDDGGEAAAVLDSLAETAVEDDVEEDSLDDVLDGLLDDADAEEDSGSAAEDALDSLA
PAETEETAGDEAGDILEGLLEGGLEQDEDTDEDPGAVLDSLETPEETDGGDSAADVLAGLAEDLPEDAPV
EEDGLDGILGGLDEPEDDAGDGDLSAALDTLETPAEDEAGDSGLDDLLAGLGGDAPGEDAAEDVPDDILA
GLAEDEDAGGADSAGLDPEALPAGGEDAEAPAGDDTLDRLLGDLTDEDESVSAENPDVLLSELEEEPSVD
SAEDGSSLDELLGGLDISDPADEDSSELNALVDGGDADGGDDLDSLLGSLDEPEDTAAGDEDDSSLDDLL
GSLDDETAAEDDAAGEDDLDALLGSLDADGAEAAEGASLDELLGDLGTEEEEGDLDGLLAGLGEEASAEE
AEDDGSAEDDLDALLGGLGDAESDLDSLMGDDGDMDLDDLLGDLGGDDEDAGDAGGEDLGALLDDLDAGG
DDPAAEAAAVDVPDDPEFAYGTLSADRPDAQKLERRRFRLAVLGDFSGRAARGQLETGDGLAARKAILLD
PDTVEDVIESFATKLVLPIGKEGAGIAVKLEDLDGLHPDELYENVELFSELVGLRKQLQSGATADHAATT
LKAWAEKYGTRARAPKRTSAGNSVPADRRLSAFQQLIGATGITPRPATPVEELLARVVGPHIRALPDPDA
AAMQKAVDEALSDAMRLVLHHPEFQSVEAQWRSLDLMARSIEDDDTLDVMLYDISAEELAADLAAEEDLS
KTGFVRLLTGEPLDEETGRGGYSALIGMYQFEETPPHAELLGRIARVAAHVDAPFFAAISPEFLKTPKAE
RPKLVADAWDTLQGMAEAGHLGLVSPRFLLRRPYGEKTEPCYEFDFEEFTETEGLKGMLWANPVVLVAIL
LGRSFRENGPSLQLGKIMTLGEMPYHYVNDKFGDQVALPCTERNIDLDKIALAQERGFMAVSAVKGRDEV
RLTSFNSLKGSEILGPWTGLPAPEPSPPDPRGMPEPAAPAGDTEDSDDLDLDLDLGGDDEDVPGLDDLDL
GDGGGDDDGLGDLDDLLASFGDDGDDDDDDGEMDADLAALLDDL
 
Nucleotide Sequence: 4965 bp     [Download]
>gi|568287774|ref|NC_023136.1|:c248992-244028 Leisingera methylohalidivorans DSM 14336 strain MB2, DSM 14336 plasmid unnamed, complete sequence
ATGGCTGACAGCTCGCAGAAGTTCATTGCCCGCAACCGGGCGCCGCGCGTTCAGATCGAATATGACGTGG
AGCTGTATGGCGCCGAAAAGAAGGTGCAGCTGCCCTTTGTGATGGGCGTGCTGAGCGACCTGGCAGGCAA
ATCCACGGTCGAGCAGCCCGCGGTTGCCGACCGCAAGTTTCTGGAAATCGACGTCGACAATTTTGACGAG
CGGATGAAGTCGATGGCGCCGCGCGCTGCGTTCACGGTTCCCAACACGCTGACCGGCGAGGGCAATCTGG
CGGTCGATCTGACGTTCAAAAGCCTGGCGGATTTTTCGCCGGGGGCCATTGCTGCCAAGGTGGACGCGCT
GCGTCCGCTGCTGGAGGCGCGCACCCAGTTGCAGAACCTGATGGCCTATATGGACGGCAAGACCGGCGCC
GAAACGCTGATCGAGACGATCCTGAACGATCCGTCGCTGCTGGCGGCGGTCTCGGCGCCGCCGGGGGACT
CCGGCAGCGCGGCAGCCTTGGAAAGCCTTCGCAGCCTGGAGTTGCCCGGGGAAGAGGCCGACAGCAGCGA
TGATGTACTGGCCGGACTTGCGGCTGCGGCACCGGAGGCTGCTGCGCCCGCGGATGAATCCGGCGGGGTT
CTGGACGCGCTGCGCGACGCGGCGCCAGAAGATCAGGCGGCCGAGGATGCCTCGGCGGGGGTTCTGGAAG
GCCTGCGGGGGGCGCCCCCCGGGGATGCAGCCCCCGAAGATACGTCCGCTGACGTGCTGGCCGGTCTGAG
CACCGCCGCACCGGCAAACCCCGAACCGCAGGACATCGCGGCGGATGCCTTGGCGGCTCTGGCTGCGACC
GGCGTGCCGGAAATGACAGAAGAGGACGGCGCCGCATCTGTTCTGGAGGGGCTGGCGCAGGCCGCTGTGC
CGGAGTCGGCAGCCGAGGATGCTTCCGGAAATGTGCTGGACGGCCTGCGGGCGGCGGCGCCGGCTGAGGA
GGACAATGAGGACGCATCGGCAGAGGTTTTGGCAGGCTTGAGCGCTGCGGAGCCGGCTGAGGAAGACCAA
GGGGATGATGCCGGTGAGGCGCTGGCGTCGCTCGCCGCGGCAGAACCGCTGGACCCGGAAGAGGAGCACG
GGGCGGACACAGTTCTGGAGGGGCTGGCGCAGGCGGAGCTGCCTGAAGCGGAGGACGCCGATACCTCCGG
CGATGTGCTGGCCGGGCTGGCGGCGCAGGAACCCGCGGACGCTGGCGCGGAGGATGCGTCAGGGGCTGCT
CTGGAAAGTCTTGCAGCCGTGGAAGTGGCGGAAGCTGAACTGGATGATCATTCCGGTGTTCTGGGCGCGC
TCGCGGACATTGATGTGCCGGAGCAGGCAGACACGGCGGCGGAGGATGCGCTGGAAGGCCTGGCGGCGGT
TGAAACTGCAGAGCAGCCCGCGGAGGACCACTCCGGCATCCTGGACGGGCTGGCAGAGCGGGCGCCGGAG
GATGAGACGGAAGACGATACCGCGGGTGCCGCCTTGGAGAGCTTGGCGGCGGCAGATGCCCCGGACGCGG
ATGCTGCTGATGAGACTGCATCGGTTCTGGATGACCTGGCCGCGGTCGAAGTGGACGGCGGCGGCGATGA
CACGGCGGGGGCCGCTCTGGACAGCCTGGCCTCGGTGGAGATCGCCGAGGACGGGACCGAAGATGTTGCC
GGCGTTCTGAGTGAACTTTCAGATGTTGCGCCGGAGGCAGAGGATGACGGCGGCGAAGCCGCTGCGGTGC
TGGACAGCCTGGCTGAAACAGCCGTCGAAGACGATGTTGAGGAAGACAGCCTGGACGACGTTCTGGACGG
CCTGCTGGACGATGCTGACGCGGAGGAAGACAGCGGCAGCGCGGCAGAGGATGCACTGGACAGCCTGGCC
CCGGCTGAGACTGAAGAAACGGCGGGAGACGAGGCCGGTGATATTCTCGAAGGCTTGCTGGAGGGCGGTC
TGGAACAGGACGAAGACACGGATGAAGATCCGGGCGCGGTGCTGGACAGCCTTGAAACGCCCGAGGAAAC
AGACGGCGGGGACAGCGCGGCAGATGTGCTGGCCGGGCTGGCGGAGGATCTTCCGGAGGACGCGCCAGTG
GAGGAGGATGGCCTGGACGGCATCCTTGGCGGGCTGGATGAACCGGAGGACGATGCCGGGGACGGCGATC
TGAGCGCTGCACTGGACACGCTTGAGACCCCTGCTGAAGATGAGGCCGGGGATAGCGGTCTGGATGATTT
GCTTGCGGGTCTTGGCGGCGATGCGCCGGGCGAGGACGCGGCGGAGGACGTCCCGGATGACATACTGGCG
GGCCTGGCCGAAGACGAAGACGCTGGCGGGGCTGACAGCGCGGGCCTGGATCCGGAGGCATTGCCGGCGG
GTGGAGAGGATGCGGAGGCGCCGGCCGGAGATGATACTCTGGACAGGCTTCTGGGAGACCTGACTGACGA
GGATGAGTCTGTATCCGCGGAAAATCCCGATGTGCTTTTGAGTGAACTGGAGGAAGAGCCGTCCGTGGAT
TCAGCGGAGGATGGCAGCAGCCTGGATGAACTGCTGGGCGGTTTGGACATTTCAGATCCCGCAGATGAGG
ACAGTTCCGAACTGAATGCGCTTGTTGATGGCGGGGACGCGGATGGCGGCGATGATTTGGACAGCTTGCT
GGGCAGTCTGGACGAGCCGGAAGATACCGCCGCTGGAGATGAAGACGACAGCAGCCTGGATGATCTGCTG
GGCAGTTTGGACGATGAAACCGCCGCCGAGGATGACGCGGCAGGCGAAGATGATCTGGATGCGCTGCTGG
GCAGTCTTGATGCGGACGGCGCAGAGGCGGCGGAGGGTGCCAGCCTTGATGAGCTTCTGGGTGATCTTGG
GACTGAGGAAGAGGAGGGCGATCTGGACGGTCTGCTGGCAGGTCTCGGCGAGGAGGCTTCGGCGGAGGAG
GCGGAAGATGACGGCAGTGCCGAGGATGACCTGGATGCGCTGCTTGGCGGTCTAGGGGATGCGGAGTCCG
ACCTGGACAGCCTGATGGGCGATGACGGGGATATGGATCTTGATGATCTGCTGGGGGATCTTGGCGGTGA
TGACGAGGATGCAGGGGACGCGGGCGGCGAAGATCTGGGCGCGCTTTTGGATGATCTGGACGCCGGGGGG
GATGACCCCGCGGCAGAGGCTGCGGCGGTTGACGTGCCGGATGATCCTGAATTCGCTTATGGCACCCTGA
GCGCGGACCGGCCTGACGCGCAGAAGTTGGAGCGCAGGCGCTTCCGGCTGGCGGTTCTGGGTGATTTCTC
AGGCCGGGCGGCCAGGGGCCAGCTGGAGACCGGCGATGGTCTGGCGGCGCGCAAGGCGATCCTGCTGGAT
CCTGACACGGTCGAGGATGTGATCGAGAGCTTTGCGACCAAGCTGGTGCTGCCGATCGGCAAGGAGGGTG
CCGGGATTGCGGTGAAGCTGGAGGATCTGGACGGGCTGCACCCGGATGAACTGTATGAAAACGTTGAGCT
GTTTTCCGAGCTGGTGGGGCTGCGCAAACAGCTGCAAAGCGGCGCGACCGCGGATCACGCGGCAACCACG
CTGAAGGCCTGGGCTGAGAAATACGGCACCAGGGCGCGGGCGCCGAAGCGGACCTCGGCGGGCAATTCAG
TGCCGGCCGACAGGCGGCTGAGCGCCTTTCAGCAGCTGATCGGGGCAACTGGCATCACCCCGCGCCCGGC
CACGCCGGTGGAGGAGTTGCTGGCGCGGGTTGTCGGCCCGCATATCCGGGCGCTGCCGGACCCGGATGCG
GCGGCCATGCAAAAGGCGGTGGATGAAGCGCTGTCGGATGCCATGCGGCTGGTGCTGCACCATCCTGAAT
TCCAGTCGGTGGAGGCGCAGTGGCGCTCGCTTGACCTGATGGCGCGCTCGATCGAGGACGACGATACGCT
GGATGTGATGCTGTATGACATCTCGGCCGAGGAATTGGCGGCGGATCTGGCGGCGGAAGAAGACCTGTCG
AAAACCGGGTTTGTGCGGCTTTTGACCGGCGAGCCGCTGGACGAGGAGACCGGGCGCGGCGGTTATTCGG
CGCTGATCGGCATGTATCAGTTTGAAGAGACGCCGCCGCATGCGGAGCTGCTGGGCCGTATTGCGCGGGT
GGCGGCGCATGTGGATGCGCCGTTTTTTGCCGCGATTTCGCCGGAGTTCCTGAAGACGCCGAAGGCGGAG
CGGCCCAAGCTGGTAGCGGACGCCTGGGATACGCTGCAGGGCATGGCGGAGGCCGGGCATCTGGGGCTGG
TCAGTCCGCGGTTCCTGCTGCGGCGCCCCTATGGTGAGAAGACCGAACCCTGTTATGAGTTTGATTTTGA
GGAGTTTACCGAAACAGAAGGTCTGAAGGGCATGCTTTGGGCCAATCCGGTGGTGCTGGTGGCAATCCTG
CTGGGGCGGTCGTTCCGTGAGAACGGGCCGTCTCTGCAGCTGGGTAAAATCATGACTTTGGGGGAGATGC
CCTATCATTATGTGAACGACAAGTTCGGCGATCAGGTGGCGCTGCCCTGCACCGAGCGCAATATTGACCT
GGATAAGATTGCGCTGGCGCAAGAACGCGGATTCATGGCGGTGAGCGCGGTCAAGGGGCGGGACGAGGTG
CGGCTGACCTCCTTCAATTCGCTGAAGGGCAGCGAGATTCTGGGGCCCTGGACCGGCTTGCCGGCGCCCG
AGCCCTCGCCGCCTGATCCGCGGGGGATGCCGGAACCGGCAGCTCCTGCGGGCGATACTGAGGACAGCGA
TGACCTGGATCTCGATTTGGATCTGGGCGGAGATGATGAGGATGTTCCCGGCCTTGATGATCTTGATCTT
GGAGACGGCGGCGGGGATGACGATGGTCTCGGGGATCTGGACGATCTGTTGGCGTCGTTCGGAGACGACG
GCGATGACGATGACGACGACGGGGAAATGGATGCAGACCTCGCCGCACTTTTGGATGATTTATGA
 Primer design