SecReT6
Protein ID: 568288025
SecReT6 ID892
T6SS typei3
Gene symbol-
Locus tagMETH_23440
StrainLeisingera methylohalidivorans DSM 14336 strain MB2, DSM 14336
Repliconplasmid [GenBank: NC_023136] [Browse all T6SS(s) in this replicon]
Location [Strand]251192..253915 [-]
ProductATPase AAA
NoteTssH
UniProt IDV9W2C5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.70E-40, Aligned region: 639..805
AAA [PF00004], Evalue: 7.90E-15, Aligned region: 237..368
AAA [PF00004], Evalue: 7.90E-15, Aligned region: 645..729
ClpB_D2-small [PF10431], Evalue: 3.30E-13, Aligned region: 218..231
ClpB_D2-small [PF10431], Evalue: 3.30E-13, Aligned region: 812..888
AAA_5 [PF07728], Evalue: 4.30E-12, Aligned region: 237..257
AAA_5 [PF07728], Evalue: 4.30E-12, Aligned region: 644..755
AAA_16 [PF13191], Evalue: 8.90E-11, Aligned region: 214..259
AAA_16 [PF13191], Evalue: 8.90E-11, Aligned region: 281..315
AAA_16 [PF13191], Evalue: 8.90E-11, Aligned region: 634..688
Clp_N [PF02861], Evalue: 5.30E-07, Aligned region: 28..75
Clp_N [PF02861], Evalue: 5.30E-07, Aligned region: 111..140
Sigma54_activat [PF00158], Evalue: 1.90E-06, Aligned region: 216..251
Sigma54_activat [PF00158], Evalue: 1.90E-06, Aligned region: 615..751
AAA_25 [PF13481], Evalue: 0.00027, Aligned region: 232..308
AAA_25 [PF13481], Evalue: 0.00027, Aligned region: 640..663
Zeta_toxin [PF06414], Evalue: 0.00029, Aligned region: 237..257
Zeta_toxin [PF06414], Evalue: 0.00029, Aligned region: 639..684
AAA_29 [PF13555], Evalue: 0.00031, Aligned region: 229..252
AAA_29 [PF13555], Evalue: 0.00031, Aligned region: 642..670
AAA_22 [PF13401], Evalue: 0.00031, Aligned region: 61..97
AAA_22 [PF13401], Evalue: 0.00031, Aligned region: 236..256
AAA_22 [PF13401], Evalue: 0.00031, Aligned region: 361..451
AAA_22 [PF13401], Evalue: 0.00031, Aligned region: 642..667
AAA_22 [PF13401], Evalue: 0.00031, Aligned region: 706..726
AAA_19 [PF13245], Evalue: 0.00036, Aligned region: 237..259
AAA_19 [PF13245], Evalue: 0.00036, Aligned region: 642..666
NACHT [PF05729], Evalue: 0.0008, Aligned region: 237..268
NACHT [PF05729], Evalue: 0.0008, Aligned region: 645..669
AAA_17 [PF13207], Evalue: 0.00084, Aligned region: 237..256
AAA_17 [PF13207], Evalue: 0.00084, Aligned region: 478..507
AAA_17 [PF13207], Evalue: 0.00084, Aligned region: 644..682
AAA_18 [PF13238], Evalue: 0.00095, Aligned region: 237..257
AAA_18 [PF13238], Evalue: 0.00095, Aligned region: 646..669
IstB_IS21 [PF01695], Evalue: 0.0014, Aligned region: 222..260
IstB_IS21 [PF01695], Evalue: 0.0014, Aligned region: 644..663
Arch_ATPase [PF01637], Evalue: 0.0049, Aligned region: 215..254
Arch_ATPase [PF01637], Evalue: 0.0049, Aligned region: 643..686
Hpr_kinase_C [PF07475], Evalue: 0.0055, Aligned region: 237..248
Hpr_kinase_C [PF07475], Evalue: 0.0055, Aligned region: 266..289
Hpr_kinase_C [PF07475], Evalue: 0.0055, Aligned region: 642..662
Hpr_kinase_C [PF07475], Evalue: 0.0055, Aligned region: 728..746
Protein Sequence: 907 a.a.     [Download]
>gi|568288025|ref|YP_008974009.1| ATPase AAA [Leisingera methylohalidivorans DSM 14336]
MTEISRVALFGKLNKLGYQAVESATVFCKMRGNPYVELVHWLHQLLAQQDSDIHRIIQHYDLDAGKIATE
LTRALDMLPRGASTISDLSDHLMDAMERGWVWGSLLYSAGQVRSGHLLLGMLKTPALRNILSNMSPELAK
VGADDLADNFHDATDGSPEERLGAQDGSNVTGGGAEPGEASGSMAPGAMGKGEALEQFCTDLTEQARNGE
IDPIVGRDEEIRQIVDILMRRRQNNPILTGEAGVGKTAVVEGFALRIARGDVPPALHDVRLLVLDVGLLQ
AGASMKGEFENRLRQVIDEVQASPVPIVMFVDETHTLVGAGGAAGTGDAANLLKPALARGTLRTIGATTW
AEYKKYIEKDPALTRRFQVVKIDEPDIPKAILMMRGIASMLEGHHRVQVLDEGIEAAVSLSARYIPARQL
PDKSVSLLDTACARVAVSQHAVPAEVDDSQRRIEALTTELEIIGRDETAGYEVADRREAVEAAKAVEEER
LAGLTERWDKEKAVVEGILDLRAKLREGAAPVDADPDAGDDGAEGAAGSPLAEDERAELMQQLKDKNAEL
EALQGDSALILPIVDHQAVASVVGDWTGIPVGRMVKDEIETILNLEERLAQRVIGQDHAMKMIAKRIQTS
RAGLDNPNKPIGVFMLAGTSGVGKTETALALAEVLYGGEQNVITINMSEYQEAHTVSSLKGAPPGYVGYG
EGGVLTEAVRRKPYSVVLLDEVEKAHPDVHEIFFQVFDKGVMEDGEGRIIDFKNTLILLTSNVGTETIMD
LCSDPDLMPEPEGMAKALRDPLVKVFPPALLGRLVAIPYYPLSPEMIGEITKLQLGRIQKRVQETHGVPF
EYSDAVVEEIVNRCQELDSGGRMIDAIVTNTMLPDISNEFLRRLMEGKEVQKVAIGVTGGEFTYAFD
 
Nucleotide Sequence: 2724 bp     [Download]
>gi|568287774|ref|NC_023136.1|:c253915-251192 Leisingera methylohalidivorans DSM 14336 strain MB2, DSM 14336 plasmid unnamed, complete sequence
ATGACCGAGATCAGCCGCGTGGCGCTGTTTGGCAAGCTGAACAAGCTGGGATACCAGGCCGTTGAGAGCG
CAACCGTGTTCTGCAAGATGCGGGGCAACCCCTATGTCGAACTGGTGCATTGGCTGCACCAGCTTTTGGC
GCAGCAGGACAGCGACATTCACCGGATCATCCAGCATTATGATCTGGATGCCGGAAAGATTGCCACCGAA
CTCACCCGTGCCCTGGATATGCTGCCGCGCGGGGCCTCGACGATCTCGGACCTGTCGGATCATCTGATGG
ATGCGATGGAACGCGGCTGGGTCTGGGGATCCTTGCTGTATTCTGCGGGTCAGGTGCGCAGCGGCCATTT
GCTGCTGGGGATGCTGAAGACGCCGGCCCTGCGCAACATCCTGTCGAACATGTCGCCGGAGCTGGCGAAG
GTCGGCGCCGATGATCTGGCGGACAACTTCCATGATGCCACCGATGGCTCGCCCGAGGAACGGCTGGGCG
CGCAGGATGGCTCCAACGTCACCGGCGGCGGCGCCGAGCCGGGCGAGGCCTCGGGGTCGATGGCGCCGGG
CGCGATGGGCAAGGGCGAGGCGCTGGAGCAGTTCTGCACCGATTTGACTGAACAGGCGCGCAACGGCGAG
ATTGATCCGATTGTCGGGCGGGACGAAGAAATCCGCCAGATCGTCGACATCCTGATGCGGCGCAGGCAGA
ACAACCCGATCCTGACCGGCGAGGCAGGGGTCGGCAAGACCGCTGTGGTCGAGGGCTTTGCCCTGCGGAT
TGCGCGCGGCGACGTGCCGCCTGCCTTGCATGATGTGCGGCTGCTGGTGCTGGATGTCGGCCTGCTGCAG
GCAGGCGCCAGCATGAAGGGCGAATTTGAAAACCGCCTGCGCCAGGTGATTGACGAGGTGCAGGCCAGCC
CGGTGCCGATTGTGATGTTTGTCGATGAGACCCACACGCTGGTCGGGGCCGGCGGTGCGGCGGGCACCGG
CGATGCGGCCAATCTGCTGAAACCGGCGCTGGCACGCGGCACGCTGCGCACCATCGGCGCCACCACCTGG
GCCGAGTATAAGAAATACATCGAGAAGGATCCGGCGCTGACCCGGCGCTTTCAGGTGGTCAAAATCGACG
AGCCGGACATTCCGAAGGCGATCTTGATGATGCGGGGCATCGCTTCGATGCTGGAAGGCCATCACCGGGT
GCAGGTGCTGGACGAGGGGATCGAGGCTGCTGTCAGCCTGTCGGCCCGGTACATCCCGGCGCGGCAGCTG
CCGGACAAATCGGTGAGCCTGCTGGATACGGCCTGTGCCCGCGTGGCGGTCAGCCAGCACGCGGTGCCGG
CCGAAGTGGATGACAGCCAGCGCCGGATTGAGGCGCTGACCACCGAACTGGAGATCATCGGCCGCGATGA
AACGGCGGGTTACGAGGTTGCTGACCGGCGCGAGGCGGTGGAGGCCGCCAAAGCAGTTGAAGAGGAAAGG
CTGGCCGGGCTGACCGAACGCTGGGACAAGGAAAAGGCGGTTGTCGAGGGCATTCTGGACCTGCGCGCCA
AGCTCCGGGAGGGAGCCGCGCCCGTGGACGCTGATCCGGATGCCGGGGATGACGGTGCGGAGGGCGCTGC
CGGAAGCCCGCTTGCGGAGGATGAGCGCGCCGAGCTGATGCAGCAGCTGAAGGACAAGAATGCCGAACTG
GAAGCGCTGCAGGGCGACTCTGCGCTGATCCTGCCGATTGTGGATCATCAGGCCGTGGCGAGCGTGGTGG
GCGACTGGACCGGCATTCCGGTGGGCCGCATGGTCAAGGATGAGATCGAGACCATTCTGAATCTGGAGGA
ACGCCTGGCGCAACGGGTGATCGGACAGGACCACGCGATGAAGATGATCGCCAAGCGGATTCAGACCAGC
CGCGCCGGGCTGGACAATCCGAACAAGCCGATCGGGGTGTTCATGCTGGCCGGGACCTCGGGCGTGGGCA
AGACCGAGACCGCGCTGGCGCTGGCCGAGGTGCTGTATGGCGGCGAGCAGAACGTCATCACCATCAACAT
GTCGGAATACCAGGAGGCCCATACCGTCAGCTCGCTGAAAGGCGCGCCTCCGGGCTATGTCGGTTATGGC
GAGGGCGGGGTGCTGACAGAAGCAGTGCGGCGCAAGCCCTACTCGGTGGTGCTGCTGGATGAGGTTGAGA
AGGCGCATCCGGATGTGCATGAGATCTTTTTCCAGGTGTTCGACAAGGGGGTGATGGAAGACGGCGAGGG
CCGCATCATCGACTTTAAGAACACGCTGATCCTGCTGACGTCGAATGTCGGCACCGAGACGATCATGGAT
CTGTGTTCCGACCCGGACCTGATGCCGGAGCCGGAAGGCATGGCGAAAGCGCTGCGCGACCCGCTGGTCA
AAGTGTTCCCGCCGGCGCTGCTGGGGCGTCTGGTAGCGATCCCCTATTATCCGCTCAGCCCGGAGATGAT
CGGGGAGATCACCAAGCTGCAGCTGGGCCGGATCCAGAAGCGGGTGCAGGAAACCCATGGGGTGCCGTTC
GAGTATTCGGACGCCGTGGTCGAGGAAATCGTCAACCGCTGCCAGGAGCTGGACAGCGGCGGCCGGATGA
TCGACGCCATCGTCACCAACACCATGCTGCCGGATATCTCAAACGAATTCCTGCGCCGCCTGATGGAGGG
CAAGGAAGTGCAGAAAGTCGCCATCGGGGTCACCGGCGGGGAGTTCACTTACGCGTTTGATTGA
 Primer design