SecReT6
Protein ID: 568288026
SecReT6 ID892
T6SS typei3
Gene symbol-
Locus tagMETH_23445
StrainLeisingera methylohalidivorans DSM 14336 strain MB2, DSM 14336
Repliconplasmid [GenBank: NC_023136] [Browse all T6SS(s) in this replicon]
Location [Strand]253917..254972 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDV9VYN9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.20E-106, Aligned region: 21..318
Protein Sequence: 351 a.a.     [Download]
>gi|568288026|ref|YP_008974010.1| type VI secretion protein [Leisingera methylohalidivorans DSM 14336]
MATGKGPRPDDLSLYGRLAMAPEKHHVFQALRVLEAHFDDAPRLGESRRPREDKLRLGQEAELAFPPSTI
AAFKPAEGGKPAVLTNRFFGLFGPQGPLPLHLTEYARDRKRNHRDPTMVAFADMLTHRLMSLLYRAWTQG
SPAVSFDRADDPMARKVSSLIGYNGFKFTGRDDMPDLAKLHFAGHLAKGAKNAEGLVSILSAFFEVPVHL
QEFVGSWLELEPDDRWQLGYGGLGQSTSIGDKVWSRSAKFRIRIGPLKLEDYERLLPGGEALKRLRAIVR
SYAGDFLDWDVNLILAGDEVPRASLGGTTRLGHTSWIRSRPDPDADQPDVNDLYLYPGFGAGAEERVEGG
I
 
Nucleotide Sequence: 1056 bp     [Download]
>gi|568287774|ref|NC_023136.1|:c254972-253917 Leisingera methylohalidivorans DSM 14336 strain MB2, DSM 14336 plasmid unnamed, complete sequence
ATGGCGACCGGAAAAGGGCCTCGGCCGGACGATCTGAGCCTGTATGGCCGGTTGGCCATGGCGCCTGAAA
AGCACCATGTTTTTCAGGCCCTGCGGGTATTGGAAGCGCATTTCGATGACGCCCCGCGTCTTGGCGAAAG
CCGCCGCCCGCGCGAGGACAAGCTGCGCCTGGGGCAGGAGGCGGAACTGGCGTTCCCGCCCTCGACCATT
GCCGCATTCAAGCCGGCCGAGGGGGGCAAACCTGCTGTTCTGACCAACCGGTTTTTCGGCCTGTTCGGGC
CGCAGGGGCCGCTGCCGCTGCATCTGACCGAATACGCCCGCGACCGCAAAAGGAACCACCGCGACCCGAC
GATGGTGGCCTTTGCCGACATGCTGACGCACCGGCTGATGAGTCTGCTGTACCGGGCCTGGACGCAGGGG
TCTCCGGCGGTCAGTTTCGACCGGGCCGATGATCCGATGGCGCGCAAAGTGTCCTCGCTGATCGGCTATA
ACGGGTTCAAGTTCACCGGCCGGGACGACATGCCCGATCTCGCCAAGCTGCATTTTGCCGGCCATCTGGC
CAAGGGCGCCAAGAATGCCGAGGGGCTGGTGTCGATCCTGTCGGCGTTTTTCGAGGTGCCGGTGCATCTG
CAGGAATTTGTCGGCAGCTGGCTGGAGCTGGAGCCGGACGACCGCTGGCAACTGGGCTATGGCGGGCTGG
GCCAGTCCACCAGCATCGGCGACAAGGTCTGGAGCCGCTCGGCCAAGTTCCGGATCCGCATCGGGCCGCT
GAAACTGGAAGATTATGAGCGGCTTTTGCCGGGCGGCGAGGCTTTGAAACGGCTGCGGGCGATTGTGCGC
TCCTATGCCGGGGATTTTCTGGATTGGGATGTGAACCTGATCCTGGCCGGCGACGAGGTGCCGCGGGCAT
CCTTGGGCGGCACCACCCGGCTGGGCCATACCAGCTGGATCCGGTCGCGCCCGGACCCCGACGCGGACCA
GCCGGACGTGAATGATTTATACCTGTACCCGGGATTTGGCGCCGGGGCTGAAGAGCGAGTAGAGGGAGGG
ATTTAA
 Primer design