SecReT6
Protein ID: 568288027
SecReT6 ID892
T6SS typei3
Gene symbol-
Locus tagMETH_23450
StrainLeisingera methylohalidivorans DSM 14336 strain MB2, DSM 14336
Repliconplasmid [GenBank: NC_023136] [Browse all T6SS(s) in this replicon]
Location [Strand]254936..256813 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDV9W3S7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 8.60E-198, Aligned region: 5..621
Protein Sequence: 625 a.a.     [Download]
>gi|568288027|ref|YP_008974011.1| type VI secretion protein [Leisingera methylohalidivorans DSM 14336]
MDTRLLTHYENELNYLRDMGGEFAAAYPKIAARLGMEGVEVLDPYVERLLEGAAFLTARVQLELELQYPN
FTSNLLEIIYPHYLAPTPSMMIASFEPDVANSAVKSGYVLKRGSTLRSRLTEGEQTPCEFRTSADLTMWP
IQITEAQYIDGRGELVAAGVAAGYDARAGIRLRIKRIDGDPISKLGMDDLSLYLTSEAGNSWPLLELLCT
QVQGIVARSTDRRADWQLPLRGAKVVQKGFSPEEALLPLPRRVYDGYRLLQEYFAMPERFRFVELQGLQA
GLKKSAGNEVDLYILLREGMPEIAPIIVPDVFKLNTVPAVNLFEKRCDRVRIAPIDTEHHVIPNRTAGLD
FEIYGLNSVVGISGEGEDDVIFRPFYSASDFTAAGESHPAYYTVKRRMRQRSEKERLRGVRSSYLGSEVY
LTLVDRSQVPYSPGLEQLAVNALCTNRDLPMLLATGNDDVFHLPEGGPVRKVTLPVSPTRPHPTLAQGDT
AWRLISHLSLNYVSIAETGKGQSAEALRELVGLYAPLGDRVTEKQLEGILSVAARPIVRRMSDEILSTAV
RGLEITLGFDESYFEGSNIYVLGAVLERFFRGYASINSFTETVLKTEKRGEIARWRPEKGLGRTI
 
Nucleotide Sequence: 1878 bp     [Download]
>gi|568287774|ref|NC_023136.1|:c256813-254936 Leisingera methylohalidivorans DSM 14336 strain MB2, DSM 14336 plasmid unnamed, complete sequence
ATGGATACACGGCTGCTGACCCATTACGAAAATGAACTGAACTACCTGCGCGACATGGGCGGCGAGTTTG
CTGCCGCCTATCCCAAGATCGCCGCGCGGCTGGGAATGGAAGGCGTTGAGGTTCTTGACCCCTATGTGGA
ACGGCTGCTGGAGGGGGCCGCCTTTCTGACTGCCCGCGTCCAGCTGGAGCTGGAGCTGCAGTATCCGAAT
TTCACGTCGAACCTGCTGGAAATCATCTATCCGCATTACCTGGCGCCGACGCCGTCGATGATGATTGCGT
CGTTTGAGCCGGATGTGGCGAATTCGGCGGTCAAAAGCGGCTATGTGCTGAAGCGGGGCTCGACCCTGCG
GTCGCGGCTGACCGAGGGCGAACAGACGCCGTGCGAATTCCGCACCTCTGCCGATCTGACGATGTGGCCG
ATCCAGATCACCGAGGCACAGTATATCGACGGCCGCGGCGAACTGGTCGCGGCGGGGGTTGCTGCGGGAT
ATGATGCCCGCGCGGGCATCCGGCTGCGGATCAAGCGGATTGACGGCGATCCGATCAGCAAACTGGGGAT
GGATGATCTGTCCCTGTATCTGACCAGCGAGGCGGGCAACAGCTGGCCATTGCTGGAGCTGCTGTGCACC
CAGGTGCAGGGGATCGTCGCGCGCTCCACCGACCGGCGGGCGGATTGGCAGCTGCCGCTGCGCGGCGCCA
AAGTGGTGCAAAAGGGTTTCAGCCCGGAGGAGGCGCTGCTGCCGCTGCCGCGCCGGGTCTATGACGGCTA
CAGGCTGCTGCAGGAATATTTTGCGATGCCGGAGCGGTTCCGTTTTGTGGAACTGCAGGGGCTGCAGGCG
GGGCTGAAGAAATCCGCGGGCAACGAGGTTGATCTGTATATCCTGCTGCGGGAGGGGATGCCGGAGATTG
CCCCGATCATTGTGCCGGATGTGTTCAAGCTGAACACGGTGCCGGCCGTGAACCTGTTTGAAAAGCGCTG
CGACCGGGTGCGGATTGCGCCGATCGATACCGAACACCATGTGATCCCGAACCGCACCGCGGGTCTGGAT
TTTGAGATCTACGGGCTGAACAGCGTGGTCGGGATCAGCGGCGAGGGGGAGGACGACGTGATCTTCCGCC
CGTTTTATTCCGCCAGTGATTTCACCGCTGCGGGCGAAAGCCACCCGGCTTATTACACCGTCAAACGGCG
GATGCGGCAGCGCTCGGAAAAGGAGCGCCTGCGCGGGGTGCGCAGCTCTTATCTGGGGTCGGAAGTCTAT
CTGACGCTGGTGGACCGGTCGCAGGTTCCCTATTCCCCGGGGCTGGAGCAGCTGGCGGTCAACGCGCTGT
GCACCAACCGCGACCTGCCGATGCTGCTGGCCACCGGCAATGACGATGTGTTCCACCTGCCCGAAGGCGG
CCCGGTGCGCAAAGTGACGCTGCCGGTCTCGCCAACCCGCCCGCATCCGACGCTGGCGCAGGGGGATACC
GCCTGGCGGCTGATTTCGCACCTCAGCCTGAACTACGTGTCGATTGCCGAAACCGGCAAGGGCCAGTCGG
CGGAGGCGCTGCGCGAGCTGGTCGGGCTTTATGCGCCCCTGGGCGACCGGGTGACGGAGAAGCAGCTGGA
GGGGATCCTGTCGGTGGCCGCCCGGCCCATTGTGCGGCGGATGAGCGACGAGATCCTGTCGACCGCGGTG
CGCGGGCTGGAGATCACCCTGGGCTTTGATGAAAGCTATTTCGAGGGCAGCAACATCTATGTGCTGGGGG
CCGTTCTGGAGCGGTTCTTCCGCGGCTATGCCAGCATCAACTCATTCACGGAGACAGTCCTGAAGACTGA
AAAACGCGGGGAAATTGCCAGATGGCGACCGGAAAAGGGCCTCGGCCGGACGATCTGA
 Primer design