SecReT6
Protein ID: 568288028
SecReT6 ID892
T6SS typei3
Gene symbol-
Locus tagMETH_23455
StrainLeisingera methylohalidivorans DSM 14336 strain MB2, DSM 14336
Repliconplasmid [GenBank: NC_023136] [Browse all T6SS(s) in this replicon]
Location [Strand]256815..257312 [-]
Producttype VI secretion protein
NoteTssE
UniProt IDV9W111
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.10E-23, Aligned region: 37..144
Protein Sequence: 165 a.a.     [Download]
>gi|568288028|ref|YP_008974012.1| type VI secretion protein [Leisingera methylohalidivorans DSM 14336]
MADKTLAERLQPSLLDRLTDNAPSDLKETRESRVIDLSRLRDIIQRDLSWLLNTQNVESHFDARRYPSVS
ASVLNYGLIEVAGEASTSEKAEAIRQSIKQAIATYEPRIIEGSVDVQLQDGTDATEMTVGLEIRADMWAQ
PMPLELYLRSKVDLTTGEVEMERAM
 
Nucleotide Sequence: 498 bp     [Download]
>gi|568287774|ref|NC_023136.1|:c257312-256815 Leisingera methylohalidivorans DSM 14336 strain MB2, DSM 14336 plasmid unnamed, complete sequence
ATGGCTGACAAAACACTGGCCGAGCGCCTGCAGCCATCGCTGCTGGACCGGCTGACAGACAATGCACCTA
GCGATCTGAAGGAAACCCGCGAGAGCCGGGTGATCGATCTTTCGCGCTTGCGGGACATCATTCAGCGCGA
TCTGTCCTGGCTGCTGAACACGCAGAATGTGGAAAGCCATTTCGATGCGCGGAGATATCCGTCGGTCTCG
GCTTCGGTGCTGAACTACGGGCTGATCGAGGTGGCGGGCGAAGCCTCGACCAGTGAAAAGGCCGAAGCGA
TCCGCCAGTCGATCAAACAGGCGATTGCCACCTACGAGCCGCGGATCATCGAAGGGTCGGTGGATGTGCA
GCTGCAGGATGGCACTGATGCCACCGAGATGACCGTGGGGCTGGAAATCCGTGCCGATATGTGGGCGCAG
CCGATGCCGCTGGAGCTGTATTTGCGCAGCAAGGTCGATCTGACCACCGGCGAAGTGGAAATGGAAAGGG
CCATGTAA
 Primer design