SecReT6
Protein ID: 568288029
SecReT6 ID892
T6SS typei3
Gene symbol-
Locus tagMETH_23460
StrainLeisingera methylohalidivorans DSM 14336 strain MB2, DSM 14336
Repliconplasmid [GenBank: NC_023136] [Browse all T6SS(s) in this replicon]
Location [Strand]257305..258108 [-]
Productvirulence protein, SciE type
NoteTagJ
UniProt IDV9W1H1
KEGG IDlmd:METH_23460
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 5.30E-43, Aligned region: 137..258
TPR_19 [PF14559], Evalue: 4.30E-05, Aligned region: 7..63
TPR_19 [PF14559], Evalue: 4.30E-05, Aligned region: 109..133
TPR_11 [PF13414], Evalue: 0.00012, Aligned region: 5..59
TPR_11 [PF13414], Evalue: 0.00012, Aligned region: 100..132
TPR_11 [PF13414], Evalue: 0.00012, Aligned region: 231..246
TPR_16 [PF13432], Evalue: 0.00059, Aligned region: 5..62
TPR_16 [PF13432], Evalue: 0.00059, Aligned region: 96..133
TPR_7 [PF13176], Evalue: 0.0012, Aligned region: 6..28
TPR_7 [PF13176], Evalue: 0.0012, Aligned region: 38..61
TPR_7 [PF13176], Evalue: 0.0012, Aligned region: 111..130
Protein Sequence: 267 a.a.     [Download]
>gi|568288029|ref|YP_008974013.1| virulence protein, SciE type [Leisingera methylohalidivorans DSM 14336]
MTPEEHLKAGDPRAALEALQQKIRGDASNAKLRVFLFQLLCVLGDWNRAIAQLKAAAGLDEGATVMAQAY
REAIICEVYREKVFAGEKAPLILGEPEQWLAHLIEAQKLLAQGNPKEAAELRAKAFDAAPASPGEINGKK
FDWIADADMRLGPVLETVVNGKYYWLPFAQIVSFEAEEPSDLRDAVWTAGTLTLAGGGSVAAMIPTRYPG
SEKADGLSMLARATVWEDAGADTYTGLGQRLLTIGDEDIAIMDVRTLRMDGHDVENG
 
Nucleotide Sequence: 804 bp     [Download]
>gi|568287774|ref|NC_023136.1|:c258108-257305 Leisingera methylohalidivorans DSM 14336 strain MB2, DSM 14336 plasmid unnamed, complete sequence
ATGACACCCGAAGAGCATTTGAAAGCTGGTGATCCCAGGGCGGCGCTGGAGGCGCTGCAGCAAAAGATCC
GGGGTGATGCGAGCAATGCCAAGCTGCGGGTTTTCCTGTTTCAGCTGCTGTGTGTGCTGGGCGACTGGAA
CCGGGCGATTGCCCAGCTGAAGGCGGCGGCGGGTCTGGATGAAGGCGCCACGGTGATGGCGCAGGCCTAC
CGCGAGGCGATCATCTGCGAAGTTTACCGCGAGAAGGTTTTTGCCGGTGAAAAGGCGCCGCTGATCCTGG
GCGAGCCGGAGCAATGGCTGGCGCATCTGATTGAAGCGCAGAAACTGCTGGCGCAGGGCAATCCCAAGGA
AGCCGCCGAGCTGCGCGCGAAGGCGTTTGATGCGGCCCCGGCCAGCCCCGGCGAGATCAACGGCAAGAAA
TTCGACTGGATCGCCGATGCCGATATGCGGCTGGGTCCGGTGCTGGAAACGGTGGTGAACGGCAAATACT
ACTGGCTGCCGTTTGCGCAGATCGTTTCTTTCGAGGCCGAGGAGCCGAGCGATTTGCGCGATGCGGTCTG
GACGGCCGGCACGCTGACCCTGGCGGGCGGCGGTTCGGTGGCGGCGATGATCCCGACGCGGTATCCGGGC
AGCGAAAAAGCCGACGGGCTGTCGATGCTGGCCCGCGCCACCGTGTGGGAGGATGCCGGGGCGGACACCT
ATACCGGCCTCGGCCAGCGGCTGCTGACGATCGGCGATGAAGATATTGCCATCATGGATGTGCGCACACT
CCGGATGGATGGGCATGACGTAGAGAATGGCTGA
 Primer design