SecReT6
Protein ID: 568288030
SecReT6 ID892
T6SS typei3
Gene symbol-
Locus tagMETH_23465
StrainLeisingera methylohalidivorans DSM 14336 strain MB2, DSM 14336
Repliconplasmid [GenBank: NC_023136] [Browse all T6SS(s) in this replicon]
Location [Strand]258200..258688 [-]
Producthypothetical protein
NoteTssD
UniProt IDV9W2D0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.50E-29, Aligned region: 2..137
Protein Sequence: 162 a.a.     [Download]
>gi|568288030|ref|YP_008974014.1| hypothetical protein METH_23465 [Leisingera methylohalidivorans DSM 14336]
MFVQISDVEGDATEEQHKKWIVIQSASWNVERAVEMTDLGSTQRMHANSNFGKIELTSQMGKASNGLALS
VANGTVRPEIIMHWCRSGDSASAGLLVYSVWKMKDVVVDSYSISASEDGIPEETWSLAYASIEHEYKSTN
QKTGKLTTEGTFKWNVQTGKVE
 
Nucleotide Sequence: 489 bp     [Download]
>gi|568287774|ref|NC_023136.1|:c258688-258200 Leisingera methylohalidivorans DSM 14336 strain MB2, DSM 14336 plasmid unnamed, complete sequence
ATGTTTGTGCAAATTTCGGATGTCGAGGGTGACGCCACCGAGGAGCAGCACAAGAAATGGATTGTCATCC
AGTCCGCAAGCTGGAATGTCGAGCGTGCCGTTGAAATGACGGATCTGGGCTCGACCCAGCGGATGCATGC
AAACTCCAACTTCGGCAAGATTGAGCTGACCTCGCAGATGGGCAAGGCATCGAACGGCCTGGCGCTGTCG
GTGGCCAATGGCACGGTGCGGCCGGAAATCATCATGCATTGGTGCCGTTCGGGTGACAGCGCCAGCGCAG
GCCTGCTGGTCTATTCGGTCTGGAAGATGAAAGACGTGGTTGTCGACAGCTACTCGATCTCCGCAAGCGA
GGACGGCATCCCGGAAGAAACCTGGTCGCTGGCCTATGCGTCGATCGAGCATGAATACAAATCGACCAAC
CAGAAAACCGGTAAGCTGACCACGGAAGGCACCTTCAAGTGGAACGTTCAGACCGGCAAGGTCGAGTAA
 Primer design