SecReT6
Protein ID: 568288031
SecReT6 ID892
T6SS typei3
Gene symbol-
Locus tagMETH_23470
StrainLeisingera methylohalidivorans DSM 14336 strain MB2, DSM 14336
Repliconplasmid [GenBank: NC_023136] [Browse all T6SS(s) in this replicon]
Location [Strand]258768..260264 [-]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDV9VYP5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.00E-191, Aligned region: 67..493
Protein Sequence: 498 a.a.     [Download]
>gi|568288031|ref|YP_008974015.1| EvpB family type VI secretion protein [Leisingera methylohalidivorans DSM 14336]
MAEEELQAEAAAGETAFGSAEFASLLQKEFRPKSDQAKTAVESAVKTLAEQALANTALVSDDALRSIESI
VSAIDAKLTEQVNLILHNEDFQQLESAWRGLHYLVNNTETDEQLKIRVMPITKKEMSKTLKKFKGTAWDQ
SPLFKKIYTEEFSQLGGEPYGSLVADYHFDHSPPDIELLGEMSKIAAAAHAPLITGAKPTLFQMDSWAEL
SNPRDLTKIFQTPEYAAWRSLRDSEDAKYVGLAMPRFLGRLPYGSKTDPVDEFAFEEDTAGATSEKYGWV
NAAYGMAVNITRSFKMYGWCSRIRGVESGGTLENLPSHTFPTTDGGVDQKCPTEIAIDDRREAELAKNGM
MPLIHRKNTDVATFMGAQSLHKPAEYDDPDATANANLGARLPYLFATCRFAHYLKCMVRDKVGSFKSRQD
MESWLQDWINNYVDFNADISSENEKARKPLAAAEVVVEEVEGNPGYYTSKFFLRPHYQLEGLSVSLRLVS
KLPSEKGG
 
Nucleotide Sequence: 1497 bp     [Download]
>gi|568287774|ref|NC_023136.1|:c260264-258768 Leisingera methylohalidivorans DSM 14336 strain MB2, DSM 14336 plasmid unnamed, complete sequence
ATGGCTGAAGAAGAACTCCAGGCGGAAGCCGCTGCCGGTGAAACCGCCTTTGGCTCGGCCGAATTCGCGA
GCCTGCTGCAAAAGGAATTCCGCCCCAAGTCGGACCAGGCCAAGACGGCGGTTGAAAGCGCCGTCAAAAC
CCTGGCCGAGCAGGCGCTGGCAAACACCGCGCTGGTGTCCGACGATGCGCTGCGTTCGATCGAGAGCATT
GTGTCGGCGATCGATGCGAAGCTGACTGAGCAGGTCAATTTGATCCTCCACAACGAGGATTTCCAGCAGC
TGGAAAGCGCCTGGCGCGGTCTGCATTATCTGGTCAACAACACCGAGACCGACGAGCAGCTGAAAATCCG
GGTGATGCCGATCACCAAGAAGGAGATGTCCAAGACCCTGAAGAAATTCAAGGGCACCGCCTGGGACCAG
TCGCCGCTGTTCAAGAAGATCTACACCGAGGAATTCAGCCAGCTGGGCGGCGAGCCCTACGGCTCGCTGG
TGGCGGATTACCATTTTGACCACTCGCCGCCGGACATCGAACTGCTGGGCGAAATGTCCAAGATCGCCGC
GGCCGCGCATGCGCCGCTGATCACCGGCGCCAAACCGACCCTGTTCCAGATGGACAGCTGGGCGGAACTG
TCGAACCCGCGCGACCTGACCAAGATTTTCCAGACCCCGGAATATGCCGCCTGGCGGTCCTTGCGCGACA
GCGAGGATGCAAAATACGTCGGCCTGGCGATGCCGCGGTTCCTGGGCCGTCTGCCCTATGGCTCGAAGAC
CGATCCGGTGGACGAGTTTGCCTTCGAGGAAGACACCGCAGGCGCCACTAGCGAGAAATACGGCTGGGTC
AACGCGGCCTATGGCATGGCGGTGAACATCACCCGCTCGTTCAAGATGTACGGCTGGTGCTCGCGGATCC
GCGGCGTGGAAAGCGGCGGCACGCTGGAGAACCTGCCCTCGCATACTTTCCCGACCACTGATGGCGGCGT
CGATCAGAAATGCCCGACCGAGATTGCCATCGACGACCGGCGCGAGGCGGAACTGGCGAAGAACGGCATG
ATGCCGCTGATCCACCGCAAGAACACCGATGTGGCCACCTTCATGGGGGCGCAATCGCTGCACAAGCCGG
CCGAATATGACGATCCGGACGCCACCGCCAACGCCAATCTGGGCGCGCGGCTGCCGTATCTGTTCGCCAC
ATGCCGGTTCGCGCACTATCTCAAGTGTATGGTGCGGGATAAGGTCGGCTCGTTCAAAAGCCGTCAGGAC
ATGGAGTCCTGGCTGCAGGACTGGATCAACAACTATGTTGATTTCAACGCGGATATCTCTTCGGAGAACG
AGAAGGCGCGCAAACCTCTGGCCGCAGCCGAAGTGGTTGTGGAAGAGGTCGAGGGCAACCCGGGGTATTA
TACCTCAAAATTCTTCCTGCGCCCGCATTACCAGCTTGAGGGGCTTTCTGTCTCGCTGCGGCTGGTATCC
AAACTGCCCTCGGAAAAGGGAGGCTGA
 Primer design