SecReT6
Protein ID: 568288032
SecReT6 ID892
T6SS typei3
Gene symbol-
Locus tagMETH_23475
StrainLeisingera methylohalidivorans DSM 14336 strain MB2, DSM 14336
Repliconplasmid [GenBank: NC_023136] [Browse all T6SS(s) in this replicon]
Location [Strand]260280..260795 [-]
Producthypothetical protein
NoteTssB
UniProt IDV9W3T3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.10E-61, Aligned region: 9..162
Protein Sequence: 171 a.a.     [Download]
>gi|568288032|ref|YP_008974016.1| hypothetical protein METH_23475 [Leisingera methylohalidivorans DSM 14336]
MAGSSQKFIARNRAPRVQIEYDVELYGAEKKVQLPFVMGVLSDLVGKSEVEQPAVADRKFLEIDVDNFDD
RMKSMAPRAAFTVPNTLTGEGNLAVDITFESMDDFKPAAIAAKVEPLRELLEARTQLSNLMTYMDGKTGA
EDLISKIIQDPSLLKTLAAQPKPGGDAESEE
 
Nucleotide Sequence: 516 bp     [Download]
>gi|568287774|ref|NC_023136.1|:c260795-260280 Leisingera methylohalidivorans DSM 14336 strain MB2, DSM 14336 plasmid unnamed, complete sequence
ATGGCCGGAAGTTCACAGAAATTCATTGCCCGCAACCGGGCACCAAGGGTCCAGATCGAATATGACGTGG
AGCTGTACGGCGCCGAGAAGAAGGTGCAGCTGCCGTTTGTGATGGGCGTGCTGAGCGACCTGGTGGGCAA
ATCCGAAGTGGAGCAGCCCGCGGTTGCGGACCGCAAGTTCCTGGAAATCGACGTTGACAACTTCGATGAC
CGGATGAAGTCGATGGCGCCGCGCGCTGCCTTCACCGTGCCCAACACGCTGACCGGCGAAGGCAATCTGG
CGGTCGATATCACCTTTGAGAGCATGGACGATTTCAAGCCTGCCGCAATTGCCGCCAAGGTGGAGCCGCT
GCGCGAACTGCTGGAGGCGCGCACCCAGCTGTCAAATCTGATGACCTATATGGATGGCAAGACCGGCGCC
GAGGATCTGATCTCGAAGATCATCCAGGACCCGAGCCTGCTGAAGACCTTGGCAGCGCAGCCGAAACCCG
GCGGCGACGCCGAGAGCGAAGAATAA
 Primer design