SecReT6
Protein ID: 568288033
SecReT6 ID892
T6SS typei3
Gene symbol-
Locus tagMETH_23480
StrainLeisingera methylohalidivorans DSM 14336 strain MB2, DSM 14336
Repliconplasmid [GenBank: NC_023136] [Browse all T6SS(s) in this replicon]
Location [Strand]260874..261944 [-]
Producttype VI secretion protein
NoteTssA
UniProt IDV9W116
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.90E-18, Aligned region: 52..112
Protein Sequence: 356 a.a.     [Download]
>gi|568288033|ref|YP_008974017.1| type VI secretion protein [Leisingera methylohalidivorans DSM 14336]
MDPAALLQSKGDDAPSGENLEYDPAFTEMELAAQPGEESVVGNEKIEATDPDYREVQKKALEVLERSHDL
RAAVFLGDALLQSEGLTGFADVTAYIRGCLEDFWESCHPELDEDDGDPTMRINAVQDLCGQPDGMAGPSP
LYRSLRRAPLAESRGFGRFCLRDIEIAEGVMTAPESMEHIPDTATIGAAFQDSDEEIVSARLAAIVSAEE
NVRAISAVFDEQTPGQGPDLSALIKLLQQIAKRIRAYGNMSAEEEAGDDGAAEDAAADGAGEAAPAAGGT
AAAAAPGVINSPADVSNALDRIIAYYRRREPSSPLPILLERAKKLVGADFLTIMNDMAPQGVENVHLIGG
IEDDDD
 
Nucleotide Sequence: 1071 bp     [Download]
>gi|568287774|ref|NC_023136.1|:c261944-260874 Leisingera methylohalidivorans DSM 14336 strain MB2, DSM 14336 plasmid unnamed, complete sequence
ATGGATCCGGCAGCATTACTGCAATCCAAAGGGGATGACGCGCCCAGCGGCGAGAACCTTGAATACGATC
CGGCCTTCACAGAGATGGAGCTGGCCGCCCAGCCGGGGGAAGAATCGGTTGTGGGCAACGAAAAGATCGA
AGCCACGGATCCGGATTACCGCGAAGTTCAAAAGAAAGCCCTGGAGGTGCTGGAGCGCAGCCATGATCTG
CGTGCCGCAGTGTTCCTGGGCGATGCGCTGCTGCAGTCCGAAGGGCTGACCGGTTTTGCCGATGTCACGG
CCTATATCCGCGGCTGCCTGGAGGACTTCTGGGAGAGCTGCCACCCGGAGCTGGATGAGGACGACGGCGA
CCCGACCATGCGGATCAACGCGGTGCAGGATCTGTGCGGCCAGCCGGATGGGATGGCGGGGCCATCGCCG
CTGTACCGCTCGCTGCGCCGGGCGCCGCTGGCCGAGAGCCGCGGCTTCGGCCGCTTCTGCCTGCGCGACA
TCGAGATTGCCGAAGGGGTGATGACCGCCCCCGAAAGCATGGAGCATATTCCCGACACGGCCACCATCGG
CGCCGCTTTTCAGGACAGCGACGAAGAAATCGTGTCGGCAAGGCTTGCAGCAATCGTGTCGGCGGAAGAG
AATGTCCGGGCAATCTCGGCTGTGTTCGATGAGCAGACACCGGGGCAGGGCCCGGATCTGAGCGCGCTGA
TCAAGCTGCTGCAGCAGATCGCCAAGCGCATCCGCGCCTACGGCAACATGAGCGCTGAGGAAGAGGCCGG
CGATGACGGCGCTGCAGAGGATGCAGCGGCTGACGGCGCCGGAGAGGCCGCTCCGGCTGCTGGCGGGACT
GCCGCGGCGGCAGCGCCGGGGGTGATCAATTCGCCCGCGGATGTGTCCAACGCGCTGGACCGTATCATTG
CCTATTACCGGCGGCGGGAGCCGTCGAGCCCGCTGCCGATTCTGCTGGAGCGGGCGAAGAAACTGGTGGG
GGCCGACTTCCTCACCATTATGAATGACATGGCCCCGCAGGGGGTGGAGAATGTCCACCTGATCGGCGGG
ATCGAAGACGACGACGATTGA
 Primer design