SecReT6
Protein ID: 568310477
SecReT6 ID895
T6SS typei1
Gene symbol-
Locus tagSCV20265_3740
StrainPseudomonas aeruginosa SCV20265
Repliconchromosome [GenBank: NC_023149] [Browse all T6SS(s) in this replicon]
Location [Strand]3986112..3987101 [-]
ProductSerine/threonine protein kinase
NoteStk1
UniProt IDV9U635
KEGG IDpaes:SCV20265_3740
PDB IDNA
Domain hit(s) vs Pfam Pkinase [PF00069], Evalue: 4.20E-40, Aligned region: 51..286
Pkinase_Tyr [PF07714], Evalue: 4.60E-25, Aligned region: 53..306
APH [PF01636], Evalue: 4.70E-05, Aligned region: 97..176
APH [PF01636], Evalue: 4.70E-05, Aligned region: 171..203
APH [PF01636], Evalue: 4.70E-05, Aligned region: 228..305
RIO1 [PF01163], Evalue: 0.0028, Aligned region: 128..202
Protein Sequence: 329 a.a.     [Download]
>gi|568310477|ref|YP_008982746.1| Serine/threonine protein kinase [Pseudomonas aeruginosa SCV20265]
MNEPLSSLELLPEEEGGANLTYFAFAAPTASAPDLPAVLPGPLPDVLSGRYRLERMLGAGGMGTVYRARD
LLHEQFGDPAPLVALKLLNESVAESPDASALLYSEFALTRRLRHPNVVRLFTFDVDTACQRAYIVMELMP
GLPLDRLLCERPEGLPWSELSAIARPLLDVLAYVHEQGVLHGDLKPSNVMLGEEGVRLFDFGLGQAQAGI
LDGLPQLSRGRIDAWTPGYAAPELLEGAPLSPAADLYALACVLYELADGRHPFRRLPSNQAREQGLERQL
RAPGHLPRRCWPALRTALSLDPERRCIGVRELQEALGARRSWLAGVLAR
 
Nucleotide Sequence: 990 bp     [Download]
>gi|568306739|ref|NC_023149.1|:c3987101-3986112 Pseudomonas aeruginosa SCV20265, complete genome
ATGAACGAACCGCTGTCGTCGCTGGAGCTGCTGCCGGAGGAGGAGGGCGGCGCGAACCTGACCTATTTCG
CCTTCGCCGCCCCGACCGCCTCGGCGCCGGACCTGCCGGCGGTGTTGCCCGGTCCGCTGCCGGACGTTCT
TTCCGGGCGCTACCGTCTGGAGCGGATGCTCGGCGCCGGCGGCATGGGGACGGTCTACCGTGCCCGGGAC
CTGCTCCATGAGCAGTTCGGCGACCCGGCGCCGCTGGTAGCGCTGAAGCTGCTCAACGAGTCGGTCGCCG
AGTCACCCGACGCCAGCGCCTTGCTCTATAGCGAGTTCGCCCTGACCCGGCGCTTGCGCCATCCGAACGT
CGTGCGTCTGTTCACCTTCGACGTCGACACCGCATGCCAGCGCGCCTACATCGTCATGGAACTCATGCCT
GGCCTGCCGCTCGACCGCCTGCTCTGCGAGCGTCCCGAAGGCCTGCCCTGGTCCGAGCTGAGCGCGATCG
CCCGGCCGTTGCTGGATGTTCTGGCCTACGTCCACGAACAAGGAGTACTGCATGGCGACCTGAAGCCGAG
CAACGTGATGCTCGGCGAAGAGGGCGTGCGGCTCTTCGACTTCGGCCTCGGCCAGGCGCAGGCAGGCATC
CTGGATGGCCTGCCGCAGCTCAGCCGGGGCCGCATCGACGCCTGGACTCCGGGCTACGCCGCTCCCGAAC
TGCTCGAGGGCGCGCCATTGTCGCCGGCGGCCGACCTGTATGCGCTGGCCTGCGTCCTCTACGAACTGGC
CGACGGTCGCCATCCGTTCCGCCGCCTGCCCTCGAACCAGGCCCGGGAGCAGGGGCTGGAGCGCCAGCTG
CGCGCGCCCGGACACCTGCCTCGGCGCTGCTGGCCGGCGCTGCGTACCGCCCTGAGCCTCGACCCCGAAC
GGCGCTGCATCGGCGTCCGCGAATTGCAGGAAGCGCTGGGCGCGCGGCGTTCCTGGCTGGCCGGCGTTCT
TGCCCGTTGA
 Primer design