SecReT6
Protein ID: 58582661
SecReT6 ID82
T6SS typei3
Gene symbol-
Locus tagXOO3038
StrainXanthomonas oryzae pv. oryzae KACC 10331
Repliconchromosome [GenBank: NC_006834] [Browse all T6SS(s) in this replicon]
Location [Strand]3264190..3267648 [-]
Producthypothetical protein
NoteTssM
UniProt IDQ5GYC9
KEGG IDxoo:XOO3038
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.00E-88, Aligned region: 197..459
IcmF-related [PF06761], Evalue: 1.00E-68, Aligned region: 510..809
DUF1215 [PF06744], Evalue: 2.70E-26, Aligned region: 896..1017
AAA_16 [PF13191], Evalue: 0.00082, Aligned region: 116..258
AAA_16 [PF13191], Evalue: 0.00082, Aligned region: 281..349
AAA_16 [PF13191], Evalue: 0.00082, Aligned region: 547..586
AAA_16 [PF13191], Evalue: 0.00082, Aligned region: 777..840
Protein Sequence: 1152 a.a.     [Download]
>gi|58582661|ref|YP_201677.1| hypothetical protein XOO3038 [Xanthomonas oryzae pv. oryzae KACC 10331]
MRFVLDFLRVRYLASAAILSLLAVLVWVGGPYLSLGRWQPFASVSGRLLAMAVLVLAWAGWRYLRWRRDS
AKQQRLAAELVGQGARAEDASGNDSRARAAQEQVRLRARFTEAMAVLRRRRRNGPGLHVLPWYLLIGAPG
SGKSTLLQSSGLEFPLKAHGTHAALEGVGGTRNCDWWFADQAVFLDSAGRYTTQDSDAIADAGAWHGFLD
LLRRHRRQPLNGVIVTVSVAELLELDGDAGLSHARAVRHRLNELVEKLRARVPVYLIVTKCDLVSGFAEF
FADLDAAGRAQVWGVSFPQAQAAGDTDPLTRFPTELERLLERIDQRVLERLHRARDARERAAVLSFPQQL
RLLQPALMDVVQTAFGRHGYAGQPWLRGVYLSSGTQQGHPIDHVISAVAQHFGVAAAGLPPVSSAPRSYF
LSRLLKDVVFAEAGLAGSQPGSAQRRRLLQLACWAVLTATTLGVLSGMAGSYARNVRLIGQVRDALDAYP
AGPLPADAGEAAFYAKALQRFDALAQARDAALPPGASIPWSRRFGLHQGTALARDVQEAYLRDLNGALLP
ALAQSLRRKLEQSSNDPQRLYPLLKGYLMLGDPTRRDAMHLATLADTVWRQIFPDDASVRAGLNLHLRAL
LGPVDGARALALDRQQIEQTRASLRTAELPALVYGGLKLTQPGVDAGQAPRLDRRLGLLSDVFERRSGLP
LSAPLPPLFTRQAFQAQIGGGIAHGVQQFLADDWVLGTAPLDPLARSQLEREVLALYQRDYIAAWDSLLA
DLVLRPVVQTGQASAVAAKLGGPASPLKALLVLLREHTHALGRTPAAKAGAGAAAAADTAAAAEPDVAAE
PIERHFEPLTRLLDGGPGASALDETLAALTQMSRTLLGAAAGVAADQNAPALLIAAQQAEQLPPPLGNWM
ATLSGRGRALTASSAGEALRNAQRQAAGRECALLVSGRFPFVPGSNNEIPLRDFAELFAPGGRMDRFAQQ
ALLGKVDTSGPGWKWNAGMAAAGADDVLARAQLADEIKQAFFAGGGAQPQVAFTVSIPPQAGIRRLQLEV
DGQALDVRDGARATQSMTWPGPTPGLVRLAAWDASGQALPVVEYRGPWAWFRVMQAGRLHRSGDLDYTAS
LALGGTSVRVDIQPASLRHPFAASAVQRFSCP
 
Nucleotide Sequence: 3459 bp     [Download]
>gi|58579623|ref|NC_006834.1|:c3267648-3264190 Xanthomonas oryzae pv. oryzae KACC10331 chromosome, complete genome
ATGCGCTTTGTGCTCGATTTCCTGCGCGTCCGCTACCTCGCCAGCGCTGCCATCCTCAGTCTGTTGGCCG
TCCTGGTGTGGGTCGGCGGACCCTATCTCAGCCTGGGCCGCTGGCAGCCGTTTGCCAGCGTGAGCGGGCG
CCTGCTTGCCATGGCCGTGCTGGTGCTCGCGTGGGCAGGGTGGCGCTATCTGCGCTGGCGCCGCGACAGC
GCCAAGCAGCAACGTCTGGCCGCCGAACTGGTCGGGCAGGGAGCACGTGCCGAAGACGCCAGCGGCAACG
ACAGTCGCGCGCGTGCAGCACAGGAGCAGGTCCGCCTGCGTGCGCGCTTTACCGAAGCCATGGCGGTGCT
GCGCCGTCGCCGTCGCAACGGTCCCGGCCTGCACGTGCTGCCCTGGTATCTGCTGATCGGCGCGCCCGGT
TCCGGCAAGAGCACCTTGCTGCAGTCTTCGGGCCTGGAGTTCCCCCTCAAGGCACATGGCACCCACGCCG
CGCTGGAAGGTGTCGGTGGCACGCGCAACTGCGATTGGTGGTTCGCCGACCAAGCAGTGTTCCTCGACAG
TGCCGGGCGCTATACCACCCAGGATTCGGACGCCATCGCCGATGCCGGTGCCTGGCATGGCTTTCTGGAC
CTGCTGCGGCGGCATCGCCGGCAGCCATTGAACGGCGTCATCGTGACCGTGAGCGTGGCCGAGCTGCTGG
AGCTCGATGGCGATGCCGGTCTGTCGCACGCGCGGGCAGTACGTCATCGACTGAACGAACTGGTCGAGAA
ACTGCGCGCACGCGTGCCGGTCTACCTGATCGTGACCAAATGCGATCTGGTGTCGGGCTTCGCCGAATTC
TTCGCCGATCTGGATGCCGCCGGCCGCGCGCAGGTGTGGGGGGTGTCGTTCCCACAGGCGCAGGCCGCCG
GTGACACCGATCCGTTGACGCGATTCCCCACCGAGCTCGAACGCCTGCTGGAGCGGATCGATCAGCGCGT
GCTGGAGCGCCTGCATCGGGCGCGCGATGCACGCGAGCGTGCCGCGGTGCTGTCCTTTCCGCAGCAATTG
CGGTTGCTTCAGCCAGCGCTGATGGACGTCGTGCAGACCGCGTTCGGCCGCCATGGCTATGCCGGCCAGC
CGTGGCTGCGTGGTGTCTATCTGAGCTCGGGGACGCAGCAAGGCCATCCGATCGACCACGTCATCTCGGC
AGTGGCGCAACACTTCGGTGTTGCCGCCGCCGGTCTGCCGCCCGTCAGCAGCGCACCACGCAGTTACTTC
CTGTCACGCCTGCTCAAGGACGTGGTCTTCGCCGAGGCGGGACTGGCCGGCAGCCAACCCGGCAGCGCGC
AGCGCCGTCGGTTGCTGCAGCTGGCCTGCTGGGCCGTGTTGACCGCCACCACCCTGGGCGTGCTGTCGGG
CATGGCCGGCAGTTACGCCCGCAACGTGCGGCTGATCGGGCAGGTGCGCGACGCGCTCGATGCCTATCCC
GCCGGCCCGCTGCCCGCCGATGCAGGCGAGGCGGCCTTCTATGCAAAAGCCTTGCAGCGTTTCGACGCGT
TGGCGCAGGCGCGCGATGCGGCGCTGCCGCCGGGCGCGTCGATTCCGTGGTCGCGACGTTTCGGGCTGCA
CCAGGGCACGGCCTTGGCGCGCGATGTGCAAGAAGCGTATCTGCGCGACCTCAATGGCGCGTTGCTGCCG
GCATTGGCGCAATCGCTGCGACGCAAGCTGGAGCAGTCCAGCAACGATCCGCAACGTTTGTATCCATTGT
TGAAGGGCTACCTGATGCTGGGAGACCCGACACGGCGCGATGCAATGCATCTGGCCACGCTGGCAGACAC
GGTCTGGCGCCAGATATTTCCCGACGATGCATCGGTGCGTGCGGGGTTGAACCTGCATCTGCGCGCCTTG
CTGGGTCCGGTGGACGGCGCGCGCGCGCTTGCGCTGGATCGGCAGCAGATCGAGCAGACACGGGCGAGCC
TGCGAACCGCCGAACTGCCGGCACTGGTCTACGGTGGCCTCAAGCTGACGCAGCCCGGGGTCGATGCCGG
CCAGGCCCCACGCCTGGATCGCCGCCTGGGCCTGCTGAGTGATGTCTTCGAACGCCGCAGTGGCCTGCCG
TTGTCTGCGCCATTGCCCCCGCTGTTCACCCGTCAAGCGTTTCAAGCACAGATCGGCGGTGGCATCGCGC
ATGGCGTGCAGCAGTTTCTCGCCGACGATTGGGTGTTGGGCACGGCACCGCTGGACCCGTTGGCGCGCTC
GCAACTGGAGCGCGAGGTATTGGCGCTGTATCAGCGCGACTACATCGCCGCCTGGGACAGCCTGCTGGCC
GATCTGGTGTTGCGGCCGGTCGTGCAGACCGGGCAGGCGAGTGCGGTGGCCGCCAAGCTGGGTGGACCGG
CATCGCCGCTGAAGGCGTTGCTGGTGTTGCTGCGCGAGCACACCCACGCACTGGGGCGCACGCCTGCAGC
GAAGGCCGGCGCGGGCGCTGCAGCTGCCGCGGACACTGCTGCTGCGGCCGAGCCGGATGTGGCAGCCGAA
CCGATCGAACGCCATTTCGAACCGCTCACTCGCCTGCTCGATGGTGGGCCGGGCGCCAGTGCGCTGGACG
AAACCCTGGCCGCGTTGACCCAGATGAGCCGCACGCTGTTGGGAGCCGCCGCTGGCGTGGCTGCCGACCA
GAACGCCCCGGCGTTGCTGATCGCCGCGCAACAGGCCGAACAGCTGCCGCCGCCGCTGGGCAACTGGATG
GCGACCTTGTCCGGTCGTGGTCGCGCATTGACCGCCAGCAGCGCCGGCGAGGCATTGCGTAACGCGCAAC
GGCAAGCCGCCGGGCGTGAGTGCGCGCTGCTGGTGAGCGGGCGTTTCCCGTTCGTGCCGGGCAGCAACAA
CGAGATCCCGCTGCGCGATTTCGCCGAACTGTTCGCACCCGGTGGGCGGATGGACCGGTTCGCGCAACAG
GCGTTGCTCGGCAAGGTCGATACCAGCGGGCCTGGCTGGAAATGGAATGCAGGCATGGCTGCGGCTGGCG
CAGACGACGTGCTGGCGCGCGCGCAACTGGCCGACGAGATCAAGCAAGCATTCTTCGCCGGCGGCGGTGC
GCAGCCGCAGGTCGCCTTTACTGTTTCCATTCCACCGCAAGCAGGGATTCGCCGGCTGCAGCTGGAGGTG
GATGGGCAAGCGCTGGACGTGCGCGATGGTGCGCGCGCCACCCAGTCGATGACCTGGCCTGGTCCAACGC
CAGGTCTGGTGCGTCTGGCGGCGTGGGACGCCAGCGGACAGGCTTTGCCAGTGGTCGAATACCGCGGCCC
CTGGGCCTGGTTTCGGGTCATGCAGGCCGGGCGGCTGCACCGCAGCGGCGATCTGGATTACACCGCCAGC
CTCGCGCTGGGCGGCACCAGCGTGCGCGTGGACATACAACCGGCCAGCCTGCGGCATCCCTTTGCGGCGT
CGGCCGTGCAGCGGTTCAGTTGCCCATGA
 Primer design