SecReT6
Protein ID: 58583140
SecReT6 ID83
T6SS typei4b
Gene symbol-
Locus tagXOO3517
StrainXanthomonas oryzae pv. oryzae KACC 10331
Repliconchromosome [GenBank: NC_006834] [Browse all T6SS(s) in this replicon]
Location [Strand]3781816..3785553 [-]
Producthypothetical protein
NoteTssM
UniProt IDQ5GX00
KEGG IDxoo:XOO3517
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.90E-74, Aligned region: 188..449
ImcF-related_N [PF14331], Evalue: 1.90E-74, Aligned region: 938..996
IcmF-related [PF06761], Evalue: 3.40E-48, Aligned region: 493..832
DUF1215 [PF06744], Evalue: 5.70E-25, Aligned region: 774..794
DUF1215 [PF06744], Evalue: 5.70E-25, Aligned region: 812..812
DUF1215 [PF06744], Evalue: 5.70E-25, Aligned region: 956..1071
DUF3007 [PF11460], Evalue: 0.0021, Aligned region: 16..61
DUF3007 [PF11460], Evalue: 0.0021, Aligned region: 448..496
DUF4446 [PF14584], Evalue: 0.0064, Aligned region: 42..107
DUF4446 [PF14584], Evalue: 0.0064, Aligned region: 448..492
DUF4446 [PF14584], Evalue: 0.0064, Aligned region: 897..950
Protein Sequence: 1245 a.a.     [Download]
>gi|58583140|ref|YP_202156.1| hypothetical protein XOO3517 [Xanthomonas oryzae pv. oryzae KACC 10331]
MFSNLRYYLRDYRLWMILGLLAAAAVAYFGTEGLREIGLWAAAVLVVCLTIWLLVWIVRRIIARRAARSL
DAMVQGEADRAVAAAQPANRADTEALRSRMLEAVKAIKSSRLGVLKGKAALYELPWYVIIGNPAAGKSTA
ILNSGLQFPFEDNRGNVIQGIGGTRNCDWYFTMTGIVLDTAGRYSVSVEDRLEWLTFLALLKKHRPRAPI
NGIIIAASIAELSGSKPEFAIELAKNLRQRVQEITQRLEVFAPVYVVFTKADLIAGFSEFFHNLDPSERE
NVWGATLPYDPTANTDALAAFDTHFDELAEGLKEMSLAHMAMQRGRQVSPGLLTLPLEFVGIKPALRTFI
ATLFEENPYQFKPVFRGFYFSSALQEGHSVHHASERVSRQFALQARAQSGEAVPSGQTAYFLKDLFRKVI
FTDKQLVRQYSSPHQNRLRYGVFLGGVAVLALALGLWTWSYTTNVQLVNNATKDLDQAVRVQANRVDLQS
RIDALLLLQDRLEQLDRYKQKGGITSGLGLYQGGNIRKKLLAEYYNGMRQVMLEPTTANLESFLGQVVSE
RDRLGKAAGPQQAAQQDSVLYQDASPTDTNDAYNALKTYLMLGNRKHVESAHLTQQLTLFWRGWLDANRG
QMTREEMTRAAEKLMTFYVAQAEDAQWPQVQTKVTLVNDSREALTRVMKGQPAMQRVFAQIKARAAARFP
TVTVNALIGEEANSGAITGSYAISGAFSREAWEEYVKDAIKEAANTQLSTTDWVLDTSEQSDLSLAGSPE
HVARELVTAYKQEYAKEWRKFIQGISVAPFHGFDQALSRMNRIGDPANSPLRKLLEKIDEQTIWDNPMAD
ALSKKASGGVVAWFQRVILRRDPAEAGKAEQQPVGPIGKTFEGLARLMTKRTDQPAVIDAYFDKLAKLRT
RMNAIKNQGQIGVGARKLMQDTFSNEGSELSAALTLVDEQMLTGLDETQRDAMRPLLLRPLTQTFAALVP
PTENEINRVWAAQVYEPFRNGIGQRYPFNLNTDVDAAPGDVAAIFGASGAIAAFNKDALGTLVIQRGNLL
ESRRWAGIGITLSSELVANYGNWVSGQSGAVAKDVSIFELLPMPAVGAIEYTIDISGQTLRYRNTPPQWM
TMQWPNAGAVPGAKITAVTSDGRSVEMFNAPGDNGLGRLIKAAAQEPVDDATRRFTWSDQGVSISVQMRI
VQSAGKATGGGDWQRGLQLPATVAGSPTTVGADAPAAAAPPGSVPAGASAQEGGQ
 
Nucleotide Sequence: 3738 bp     [Download]
>gi|58579623|ref|NC_006834.1|:c3785553-3781816 Xanthomonas oryzae pv. oryzae KACC10331 chromosome, complete genome
ATGTTCAGCAATCTCAGGTATTACCTTCGCGATTACCGTCTCTGGATGATTCTCGGCTTGCTCGCCGCCG
CCGCAGTCGCCTACTTCGGCACCGAGGGCTTGCGCGAAATTGGCCTGTGGGCGGCGGCGGTGCTGGTGGT
CTGTCTGACGATATGGCTGCTGGTGTGGATCGTGCGCCGGATCATCGCGCGCCGCGCTGCGCGCAGCCTG
GATGCGATGGTGCAAGGCGAAGCCGATCGCGCGGTCGCCGCCGCGCAGCCGGCCAACCGCGCCGACACCG
AAGCGCTGCGCTCGCGCATGTTAGAGGCGGTCAAGGCGATCAAGTCCTCGCGCCTGGGCGTGCTCAAGGG
CAAGGCGGCGCTGTACGAACTGCCGTGGTACGTGATCATTGGCAATCCTGCGGCTGGCAAGAGCACCGCG
ATCCTCAATTCCGGGTTGCAGTTCCCGTTCGAGGACAATCGCGGCAACGTGATCCAGGGCATCGGTGGCA
CGCGCAATTGCGATTGGTACTTCACCATGACCGGTATCGTGCTTGATACCGCCGGTCGGTATTCGGTCAG
TGTCGAAGACCGCCTGGAATGGCTCACCTTTCTCGCGCTGCTGAAAAAGCACCGGCCGCGCGCGCCGATC
AACGGCATCATCATCGCCGCCAGCATCGCCGAACTGTCCGGTAGCAAGCCCGAGTTCGCGATCGAGCTGG
CCAAGAACCTGCGCCAGCGCGTGCAGGAAATCACCCAGCGCCTGGAAGTGTTCGCGCCGGTGTACGTGGT
GTTTACCAAGGCCGACCTGATCGCCGGCTTCTCCGAATTCTTCCACAATCTGGATCCGTCCGAGCGCGAG
AACGTGTGGGGTGCGACCCTGCCCTACGATCCGACCGCCAATACCGATGCGCTGGCCGCCTTCGACACTC
ATTTCGACGAACTGGCCGAAGGCCTCAAGGAAATGAGCCTGGCGCACATGGCGATGCAGCGTGGGCGTCA
GGTGTCGCCGGGCCTGCTGACACTGCCGCTGGAGTTCGTCGGCATCAAACCGGCGCTGCGCACCTTCATC
GCCACGCTGTTCGAAGAAAACCCCTATCAGTTCAAGCCGGTGTTCCGCGGTTTCTACTTCAGCAGCGCGT
TGCAGGAAGGCCATTCCGTGCACCACGCCTCCGAGCGGGTGAGCCGCCAGTTCGCGCTGCAGGCGCGTGC
GCAATCCGGCGAAGCGGTGCCGTCGGGACAGACCGCTTACTTCCTGAAAGACCTGTTCCGCAAGGTCATC
TTCACCGACAAACAGCTCGTCCGGCAGTACTCCAGCCCGCACCAGAACCGCCTGCGCTACGGTGTCTTCC
TCGGTGGCGTCGCCGTGCTGGCGTTGGCGCTGGGTCTGTGGACCTGGTCGTACACCACCAACGTGCAACT
GGTGAACAACGCCACCAAGGATCTGGATCAGGCCGTGCGCGTGCAGGCCAACCGGGTCGACTTGCAATCG
CGCATCGACGCGCTGCTGCTGTTGCAGGATCGGCTCGAGCAGCTGGACCGCTACAAGCAAAAGGGCGGCA
TCACCTCCGGGCTGGGCCTGTACCAGGGCGGCAACATCCGCAAGAAGCTGCTGGCCGAGTACTACAACGG
CATGCGCCAGGTGATGCTTGAGCCGACCACCGCCAATCTGGAGTCGTTCCTGGGGCAAGTGGTCAGCGAG
CGCGACAGGCTCGGCAAGGCGGCCGGCCCGCAGCAGGCCGCGCAGCAAGACAGCGTGCTGTATCAGGACG
CGTCGCCGACCGATACCAACGACGCCTACAACGCGCTGAAGACCTACCTGATGCTGGGCAACCGCAAGCA
CGTGGAGAGCGCGCACCTGACGCAGCAGCTGACCCTGTTCTGGCGCGGCTGGCTGGACGCCAATCGCGGC
CAGATGACCCGCGAGGAGATGACCCGCGCGGCCGAGAAGCTGATGACGTTCTACGTCGCCCAGGCCGAAG
ATGCGCAGTGGCCGCAGGTGCAGACCAAGGTCACCCTGGTCAACGACAGCCGCGAGGCGCTGACCCGGGT
GATGAAGGGCCAGCCGGCGATGCAACGCGTATTCGCGCAGATCAAGGCGCGCGCGGCGGCGCGCTTCCCC
ACGGTGACGGTCAACGCGCTGATCGGCGAGGAAGCCAACAGCGGCGCGATCACCGGCAGCTATGCCATTT
CCGGGGCGTTCTCGCGCGAGGCGTGGGAAGAATACGTCAAGGACGCGATCAAGGAAGCGGCCAATACGCA
GCTCAGCACCACCGACTGGGTCCTGGACACGAGCGAGCAGAGCGACCTGTCGCTGGCCGGCAGCCCTGAG
CACGTCGCGCGCGAACTGGTGACGGCGTACAAGCAGGAATACGCCAAGGAGTGGCGCAAGTTCATCCAGG
GGATCAGCGTGGCGCCGTTCCATGGCTTCGACCAGGCGCTGTCGCGGATGAATCGCATCGGCGATCCGGC
CAACTCGCCGTTGCGCAAGCTGCTGGAAAAGATCGACGAGCAGACCATCTGGGACAACCCGATGGCCGAC
GCCTTATCGAAGAAGGCGTCCGGCGGGGTCGTCGCCTGGTTCCAGCGGGTGATCCTGCGCCGCGATCCGG
CCGAAGCCGGCAAAGCTGAGCAGCAGCCGGTCGGCCCGATCGGCAAGACCTTCGAGGGCCTGGCGCGGCT
GATGACCAAGCGCACGGACCAGCCGGCGGTCATTGATGCCTACTTCGACAAGTTGGCCAAGTTGCGCACG
CGCATGAACGCGATCAAGAACCAGGGCCAGATCGGCGTCGGCGCGCGCAAGCTGATGCAGGACACCTTCA
GCAACGAAGGCTCCGAACTCAGCGCCGCGCTGACCCTGGTGGACGAGCAGATGCTGACCGGGCTGGATGA
AACCCAGCGCGACGCGATGCGTCCGCTGTTGCTGCGTCCGTTGACCCAGACCTTCGCCGCGCTGGTGCCG
CCGACTGAGAACGAGATCAACCGGGTGTGGGCGGCGCAGGTCTACGAACCGTTCCGTAACGGCATCGGCC
AGCGCTATCCGTTCAACCTCAACACGGACGTGGATGCCGCCCCCGGCGACGTGGCTGCGATCTTCGGCGC
CAGCGGCGCGATCGCCGCGTTCAACAAGGACGCACTCGGCACCTTGGTGATCCAGCGCGGCAACCTGCTC
GAATCGCGGCGTTGGGCGGGCATCGGCATCACCTTGTCCAGCGAACTGGTGGCCAACTACGGCAACTGGG
TCAGCGGCCAGTCCGGCGCGGTGGCCAAGGACGTCAGCATCTTCGAGCTCCTGCCGATGCCGGCGGTAGG
CGCGATCGAATACACCATCGACATCTCTGGCCAGACGCTGCGCTACCGCAACACCCCGCCGCAGTGGATG
ACCATGCAGTGGCCGAACGCCGGTGCGGTGCCCGGTGCCAAGATCACCGCGGTCACCAGCGACGGGCGCA
GCGTCGAGATGTTCAATGCGCCTGGCGACAATGGCCTTGGCCGCTTGATCAAGGCAGCCGCCCAGGAACC
CGTGGACGATGCCACCCGTCGCTTCACCTGGAGCGACCAAGGCGTGTCCATCAGCGTGCAGATGCGCATC
GTGCAGAGTGCCGGCAAGGCTACCGGGGGGGGCGACTGGCAGCGTGGCCTGCAACTTCCGGCGACGGTGG
CCGGTAGCCCGACAACCGTCGGTGCCGATGCGCCAGCGGCCGCTGCGCCGCCCGGTTCGGTTCCGGCGGG
TGCGTCCGCACAAGAAGGTGGCCAATGA
 Primer design