SecReT6
Protein ID: 597513609
SecReT6 ID900
T6SS typeN/A
Gene symbol-
Locus tagBN49_0939
StrainKlebsiella pneumoniae str. Kp52.145
Repliconchromosome [GenBank: FO834906] [Browse all T6SS(s) in this replicon]
Location [Strand]957862..961227 [-]
Product-
NoteTssM
UniProt IDW9BN83
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.00E-68, Aligned region: 402..719
IcmF-related [PF06761], Evalue: 3.00E-68, Aligned region: 780..827
DUF1215 [PF06744], Evalue: 1.30E-36, Aligned region: 435..469
DUF1215 [PF06744], Evalue: 1.30E-36, Aligned region: 844..963
Protein Sequence: 1121 a.a.     [Download]
>gi|597513609|ref|CDO12700.1| - [Klebsiella pneumoniae]
MKSANNKLTIIADVLLLLLFAAVLGFIIWRFGDLFGLTGDKNKFYIWLAGIMSFIFLRASWYFSRLYRVR
RERRQSEEQGEYPEKEIRYEPGQRTSLYSELFFHLRDRYGLFWQRQVRLLLVTGEPEQVEAIAPGLTEQR
WQEGDHTVLIYGGKASAEPDTTLLASLKKLRRFRPLDGIIWPLTEKQSTQTAQLDKGWRELGNGGKLLGF
QAPLYLWQVCDDGGYQAGRTLQSVGCLLPERSTPEQLATQLEAQTPQLTEQGMSQLLTNNRHDFLLRLAH
TLTERGIAHWQTVLKPLLAGGAFPSLHLRGLMFSPPLAAVPEAAPHAWLSSLVWAGVTGDNAKGRTVGFP
WLRTALMACFCVLAIWWTGMMTSFFANRALIQETGTHTARAINTRLPLAEQLVALHTLQGELERLQYRIR
HGTPWYQRFGLERNAQLLNTAFPGYAQAANRLVRDVAVAHLQQQLNAFVALSPNSPQRTATGELRYKQLK
ALLMTSRPEKADAAFFSTTLKADNLRYADVTEGTRQSVLPSLLTFWMANLPEHPQWKIAPQPELVGAVRK
ILLRQIGVRNAENTLYQNVLKQVCRNYADMTLADMTGDTQAGSLFGTEQTVPGMFTRQAWEGQVKEAIEQ
VATARREEIDWVLSDRQQDASADISPEALRTRLMERYFTDFAGSWLTFLNSIRWKKEDSLSGVLDQLTLM
ADARQSPLIALTDTVAWQAAAGRESRSLSDSLTQSAKELFSGKEKTPQNTRAAREEEAPTGPMDKTFAPL
LRLTGDKAGGTGDSQLSLQTYLTRVTRVRLKLQQVTNAPDPQEMTQQLAQTVLQGKTVDLTDTRDYGRLI
AASLGEEWSGFGQSLFVRPVEQAWRQVLTPAADSLNRQWQRAIVSHWNQDFAGRYPFKNTPNDASLPLLA
KYLRDDGRISQFIATNLAGVLEREGRYWVADTMNTQGLTVNPAFLRALNRLRDVADTAFASGDAGVHFEL
MAKPARDVMKTHLVIDGQQLEYFNQKERWQRFSWPDEQWQPGASLSWTSTQNMERILADFRGSWSFIRLL
EQAQVTQLDSSSFMLQWQAPDGLPLHYLMRVEQGKGPLALLALKNFRLPGQVFLTGKAISDAEEYRDNAD
E
 
Nucleotide Sequence: 3366 bp     [Download]
>gi|597513609|emb|FO834906.1|:c961227-957862
atgaaatctgcaaacaataagttaacgattattgcagacgtattgctgctcctgctttttgcggctgtat
tgggttttattatctggcgttttggtgatctttttggattaaccggggataaaaataagttttatatatg
gctggctggcataatgtcgtttatttttctgcgggcatcctggtatttttcccgtttatacagggttcgc
agggaacggcggcagtctgaggaacagggggaatacccggaaaaagaaattcgttatgaacctgggcaaa
gaacatctttgtattctgaactattttttcatcttcgcgaccgttacggtctgttctggcagcgtcaggt
ccgtctgctgctggtgacgggcgagcctgagcaggtggaagccatcgcgccggggctgacagagcagcgc
tggcaggaaggcgaccatacggtgttgatatatggcggcaaggcgtcggcagagccggataccaccctgc
tggcctccctgaaaaaactgcgccgcttccgcccgctggacggtattatctggccgctgacggagaaaca
gagtacccagacggcgcaactggataagggctggcgcgaactgggtaatggtggaaaattgcttggcttt
caggctccgctgtatctgtggcaggtctgtgatgacggaggttatcaggccgggcgcacactacaaagcg
tcggctgcctgctgccggagcgaagcacaccggaacaactggctacacaactggaagcacagaccccgca
actgacggaacagggaatgtcgcagttgctgaccaataaccggcacgattttctgttgcgtcttgcccac
acacttacagagcgcggcatcgctcactggcaaaccgtcctgaagcccttgctggcaggcggcgcattcc
cttctctgcacctgcgcggcctgatgttcagccctccactggccgccgtgccggaagcggctccccacgc
gtggctgtcatcgctggtgtgggcgggcgttactggcgacaatgcaaaaggccgcaccgtgggctttccg
tggctgcgcaccgcgctgatggcctgcttctgcgtgctggcgatatggtggaccggaatgatgacctcgt
tctttgccaaccgcgccctgattcaggaaaccgggacgcacacagcgcgggccatcaatacccgactgcc
gctggcagagcaactggttgcgctgcacaccttgcagggcgagctcgagcgtctgcagtatcgtatccgc
cacggtacgccgtggtatcagcgtttcggtctggagcgtaatgctcagttgctgaacacggcgttccccg
gctatgcgcaggcggcaaaccgactggtacgcgatgtagcggtcgcccacctgcagcagcaactgaacgc
ctttgtcgccctgtctccgaacagtccgcaacgcaccgcaacgggagaactgcgttataagcaactgaag
gcgctgctgatgacgtcccgtcccgaaaaagccgacgccgcctttttcagtaccacgctgaaggcagata
acctgcgctatgcagatgtaacggaaggtacccggcaaagcgtgctgccgtcgctgctgaccttctggat
ggcgaatctgccggagcatccacagtggaaaatcgccccgcagccggaactggtcggcgcggtacgcaaa
attctgctgcgccagattggggtgcgcaatgcggaaaataccctctatcagaacgtcctgaaacaggtct
gccgcaactacgccgatatgacgctggcggatatgaccggcgacacgcaggccggctcgttgtttggtac
tgagcaaacggtgccgggaatgttcacccgccaggcatgggaaggtcaggttaaggaggccatagagcag
gtggcgacggcccgacgtgaggaaatcgactgggtactcagcgaccgtcaacaggacgcttccgccgata
tttcgccggaagccctgcgtacccgcctgatggaacgttacttcaccgacttcgccggaagctggctgac
attcctcaatagcattcgctggaagaaagaggactcgctgtccggcgtgctggaccaactgacgctgatg
gccgatgcccgccagtcgccgctgattgcgctcacggatacggtggcatggcaggcggcggcaggaaggg
aaagccgtagtctgtcagactcgctgacacaatcagcaaaagagttgtttagcggtaaagaaaaaacacc
gcagaacacccgtgccgcccgtgaagaagaagcaccaacgggaccgatggacaaaacctttgccccgctg
ctgcggctgaccggtgataaagccggaggcactggcgacagccagctcagtctgcaaacttacctcaccc
gcgtgacccgcgtgcgcctcaagctgcaacaggtcaccaacgccccggacccgcaggagatgacgcagca
gctggcgcagacggtattgcagggcaaaaccgtcgacctcaccgatacccgagattatggccgtctgata
gccgccagtctgggcgaggaatggagcggcttcggccagtcgctgtttgttcgtccggtggagcaggcgt
ggcggcaggtgctgacgcccgcagcggacagtctgaaccggcagtggcagcgggccattgtcagccactg
gaatcaggatttcgccgggcgttatccgtttaagaacactccgaacgacgcctctctccccctgctggct
aaatatctgcgcgatgacggacgtataagtcagtttatcgctaccaaccttgcaggcgttctggaacgcg
aaggtcgttattgggtggctgacaccatgaacacgcagggactgacggtcaacccggcgtttttacgcgc
cctgaatcgcctgcgcgatgtggccgacacagcctttgccagcggcgatgccggggtacattttgaactg
atggcaaaaccggcacgtgacgtgatgaaaacgcatctggtgattgacggccagcaactggaatatttca
accagaaagaacgctggcagcgtttcagctggccggatgagcagtggcagcctggcgcatcgctgagctg
gaccagtacgcagaatatggaacgtattctggccgacttccggggaagctggagctttattcgtctgctg
gaacaggcgcaggtcacacagctggacagcagcagctttatgctgcagtggcaagcgccggacggtctgc
cgctgcattacctgatgcgcgtcgaacagggtaaagggccgttggcgctgctggcgttgaaaaacttccg
cctgccgggacaggtgtttctgaccgggaaagccataagtgatgcagaagaatacagggacaacgcagat
gagtga
 Primer design