SecReT6
Protein ID: 597515139
SecReT6 ID899
T6SS typei2
Gene symbol-
Locus tagBN49_2475
StrainKlebsiella pneumoniae str. Kp52.145
Repliconchromosome [GenBank: FO834906] [Browse all T6SS(s) in this replicon]
Location [Strand]2581020..2584415 [+]
Product-
NoteTssM
UniProt IDW9BP39
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.10E-69, Aligned region: 405..723
DUF1215 [PF06744], Evalue: 3.90E-33, Aligned region: 241..274
DUF1215 [PF06744], Evalue: 3.90E-33, Aligned region: 846..966
Protein Sequence: 1131 a.a.     [Download]
>gi|597515139|ref|CDO14231.1| - [Klebsiella pneumoniae]
MRKNIRLVGFGLLILVILFLIVLLISQINKIPAVIEGYSTWLKIGAIIGISCISCITAQFVLSERHIETP
FTPDDENYVNEMYYATAENNNELKKYLQHRYSFFWHRKVRLLLVTGDEAAIEQLVPGLRQQRWLEGQRTV
LIYGGSLLSEPDSEQYAALRKLRRGRPLDGIVRVMPSSLTLTPQISESDLHGLEKISELLGYAAPVWLWK
LCDSEWPQADRAVQAVGVSFPLRATEEDVARQLAQMLPTLREQGMHQIAADTRHDFLLRLGQQLIDGGIA
QWRWQLAPWLTASRQRHALRGLMFSLPEPRTVDPYQEADTSPAGQPHLLTLPATWLGIVDDCRRLRGHHV
GMAWERGLACGLLAILGLWAAGLLLSFALNYSQIASVAGKARDLVAHPSVSDYQLTALHALRNEAGRLVH
DGQKGAPWYRRFGLDHHQQLLNAVLPWYGVANHRLIRDPANAALQQALSALVNSAPNSDQRARLAKPGYD
QLKAWLMMARPDKADGAFFAQTMKTVQPTRMGISTGLWQSLAPDLWAFYLSLLPERPEWKIIPDAQRVSQ
SRQVLLQQLGRRNAESTLYENMLKSVRRNFADVSLEDMTSGTDARRLFTTDEVVPGMFTRQAWEGGIQQA
IDKAASSRREEIDWVLSDSRKTMSTDLSPEALKARLTRRYFTDFAGSWLNFLNSLRLNPATNIADVTDQL
TLISDVRQSPLIALMNTLAWQGQAGQQRKGLSDSLIKSAKDLVGGKDKPVIDQSAAGPQGPLDDTFGPLL
QLMGKNTGSNVMSADSSLSLQTYLTRITRVRLRLQQVANASDPLEMMQTLAQTVFQGKSVDLTDTQQYGS
LISASLGEEWSGFGNTLFVQPLTQAWETVLLPSATSLNDKWRRSVVANWHTAFDGRFPFAASKSDASLPM
LAEFVRKDSGRIERFLTTELNGVLHKEGSHWVPDKVNSHGLVFNPAFLRAINQLSQLSDILFTDGSQGIS
FELQARPAPEIVETQLTIDGQKLRYFNQMADWQTFRWPGETYKPGTLLTWTTVNAGTRLFGDYSGTWGFI
RWLEQGKRHPLDRSQWMMSFSAPDGRTLQWVLRSQLGSGPLALLALRGLTLPDQIFTVDAAESAQTLTTG
LGNSDMDEMEL
 
Nucleotide Sequence: 3396 bp     [Download]
>gi|597515139|emb|FO834906.1|:2581020-2584415
atgagaaaaaacatacgattggtaggttttggtctcctgattttggttatcttgttcctgattgttttat
taatttctcagataaataaaatccctgctgttattgagggatattccacttggttaaagataggcgcgat
tataggaatatcttgcatttcctgcataacagctcagttcgtcttatctgagaggcatattgaaacacca
tttacccctgatgatgagaactatgtcaacgagatgtattatgcgacggcagagaacaacaatgaattaa
aaaaatatcttcagcaccgctatagtttcttttggcaccgcaaagtccgcctgctgctggttaccggcga
cgaggcggcaatcgaacaactggtgccaggcctgcgacagcagcgctggctggagggccagcgtaccgtt
ctgatttacggcggcagtctgctctccgagcccgacagtgagcaatatgccgcgctgcgcaagctgcgcc
gtggccgtcctctggacgggattgtgcgggtgatgccgtcgtctctcaccctgacgccgcagataagcga
gagcgacctgcacgggctggaaaaaatcagcgaactgctgggctatgccgccccggtctggttatggaaa
ctgtgcgacagtgagtggccgcaggctgaccgcgcggtgcaggcggtaggggttagcttcccgttgcgcg
ccactgaggaagatgtcgcccgtcagcttgcgcagatgttgcccacgctacgggagcaggggatgcacca
gatcgcagcagatacccgccacgactttctgctgcgtctggggcagcagcttatcgacggggggatcgcg
caatggcgctggcagctggcgccgtggctgaccgcctcgcggcagcggcatgcgctgcgaggcctgatgt
ttagcctgccagagcctcgtaccgtagatccgtatcaggaggcggatacctcgcctgcgggccagcctca
tctcctgacgctgcccgccacctggctggggatcgtcgatgactgccgccgtttacgcgggcatcacgtg
ggaatggcgtgggagcggggcctggcgtgcggtctgctggccatcctcggtctgtgggcggcgggactgc
tgctctcctttgccctcaattacagtcagattgcttcggtagcgggaaaagcccgcgacctggtggccca
cccctccgtttctgactatcaactgacggccctccatgccctgcgcaatgaggccggccgtctcgtgcac
gatgggcagaagggagcgccctggtatcggcgctttggtctggaccatcatcagcaactattaaacgccg
tcctgccctggtacggtgtggcaaatcatcgcctgatacgtgacccggccaatgccgcgttgcagcaggc
gctcagcgcgctggtcaactccgcccccaatagcgaccaacgagccaggctggcgaaaccgggctatgac
cagctgaaagcctggctgatgatggctcgtccggataaagccgatggcgcattttttgcgcagaccatga
aaacggtccagccgacgcgaatggggatctcgaccggtctgtggcaaagtctggcgccggatttgtgggc
cttttatctctccctgctgcccgagcggccagagtggaagatcatcccggatgcgcaacgggtgagtcag
agccgtcaggttctgttgcagcagctaggtcgccgcaatgccgaaagcaccttatatgagaacatgctca
aatccgtgcgtcgtaattttgccgatgtgtcgctggaagacatgaccagtggcaccgacgcgcgccgcct
gtttaccaccgatgaagtggtcccggggatgtttacccgccaggcatgggaaggtggcattcagcaggcc
attgataaggcagccagctcgcgccgggaggaaatcgactgggtgctgagcgattcgcgcaaaacgatgt
cgacagacctgtcgccggaggcgctgaaagcgcgtctgacccgacgctacttcaccgatttcgccggcag
ctggctgaattttctcaacagtctgcgacttaatccggcgaccaatatcgccgatgttaccgaccagctc
acgctgattagcgatgtccgccagtcgccgctgattgccctgatgaatacccttgcctggcaggggcagg
cggggcaacaaaggaaggggctgtcggacagccttattaaatcggccaaagatctggtgggcgggaaaga
caagccggtcatcgaccagtcggcagccggcccgcaggggcctctggatgacacgttcggcccactgctc
cagctgatggggaaaaacacgggcagcaacgtcatgtcggccgatagctccctgagcctgcaaacctatc
tgacccgtatcacccgcgtgcgcctgcgcctgcagcaggttgcgaatgcctccgatccgctggagatgat
gcagactctggcgcagaccgtcttccaggggaaaagcgtcgacctgaccgacacgcaacagtacggtagc
ctgatttcggcaagccttggcgaagagtggagtggcttcggcaacactctgtttgtgcagccgctgactc
aggcctgggaaaccgtgcttctgccgtcggcgaccagtctgaatgataaatggcgccgttcggtggtcgc
caactggcacaccgcctttgacggacgctttccgtttgccgccagcaaaagcgacgcctccctgccgatg
ctggctgagtttgtgcgcaaagacagcgggcgaatcgaacgttttctcacgacggagctgaacggtgtcc
tgcataaagaaggtagtcactgggtgccggataaggtcaacagtcacggcctggtctttaatccggcctt
tctgcgcgcgatcaaccagctaagccagctgtccgacattcttttcaccgacggcagccaggggatcagc
tttgagttacaggccaggcctgccccggagattgtcgagacacagctgacgatagacggccaaaagctgc
gctatttcaatcagatggccgactggcagactttccgctggccgggggagacgtataaacccggcactct
gctgacctggaccaccgtcaatgcgggcacgcgtctgttcggtgactacagcggtacctggggttttatt
cgctggctggagcagggtaaacgccatccgctggatcgcagccagtggatgatgagcttctccgctccgg
atggccgcaccctgcagtgggtattgcgctcccagcttgggagtggcccgctggcgcttctggcgctgcg
cggattgaccctgccggatcagattttcactgtcgatgcggctgagagcgcacagaccctgacgacgggg
ttagggaatagtgacatggatgagatggaattatga
 Primer design