SecReT6
Protein ID: 597516014
SecReT6 ID898
T6SS typeN/A
Gene symbol-
Locus tagBN49_3355
StrainKlebsiella pneumoniae str. Kp52.145
Repliconchromosome [GenBank: FO834906] [Browse all T6SS(s) in this replicon]
Location [Strand]3477664..3479079 [-]
Product-
NoteTssA
UniProt IDW9BPL4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 6.70E-51, Aligned region: 36..61
DUF3702 [PF12486], Evalue: 6.70E-51, Aligned region: 90..178
DUF3702 [PF12486], Evalue: 6.70E-51, Aligned region: 303..447
ImpA-rel_N [PF06812], Evalue: 1.30E-17, Aligned region: 41..100
ImpA-rel_N [PF06812], Evalue: 1.30E-17, Aligned region: 324..340
ImpA-rel_N [PF06812], Evalue: 1.30E-17, Aligned region: 356..374
Protein Sequence: 471 a.a.     [Download]
>gi|597516014|ref|CDO15107.1| - [Klebsiella pneumoniae]
MMTTHHDRHYKAGGDPRTLADFMALRAEMNKLSHPARPDINWPYAEQLARGLLEHHGADLQTVAWYTLAR
ARLGGVAGINEGLTLMESLLVRQGKNLWPQALPAQTEIFRTLSKRLRQVIRTLNLTPEDVESLEQAERSL
QSFDAVLQRLEIAPENQLSDLRALLHSTATRFESLDPAPALPTAPPVAVSDAELPGTLVSEEDAAKVEPV
PDLKRRPKAEPLAPPSPAKRPAPVAASTPAPVPRWKPFIAGMVTMLAVTGIAVGGWLALRQSDLPPISVT
QNAGPIPGLPATTPPGPVDLPQTQRQLGELARLAPDWAVSYGDQLVHHALIRWPDQAQPLAQQWRQQLSA
GALPAENITGWSEGMQQLQRLADQLNALDEQKGKYLTVSELKTAVFAITQSFNRAVPLEEQLRQLAALPV
DQPWPAARGSLAELHLQQLIVEYALLKRKQPASPTAALPATGEPSVSEAVK
 
Nucleotide Sequence: 1416 bp     [Download]
>gi|597516014|emb|FO834906.1|:c3479079-3477664
atgatgacaacacaccacgaccgtcactataaagccggtggcgacccgcgcacgctggctgattttatgg
ccctgcgtgcggaaatgaacaagctcagccacccggcgcggccggatattaactggccgtatgccgagca
gcttgcccgcgggctgttggagcatcacggcgcggacctgcagactgtcgcctggtataccctggcccgc
gcccggctgggcggggtggcagggatcaatgaggggctgacgctgatggagtcgctgctggttcgtcagg
ggaaaaacctgtggccacaggcgctcccggcccagacagagatcttccgcaccctgagcaagcggctgcg
gcaggtgatccgtaccctgaatcttaccccagaggatgttgagtcgcttgagcaggctgaacgttcgctg
caaagcttcgacgcagtgctccagcgccttgagatcgctcctgaaaaccagctgagcgacctgcgggcgc
tactgcacagcacggcaactcgcttcgagagcctcgaccctgcgccagcgcttcccaccgcgccgccggt
ggcggtgtctgacgcggaacttcccggcactctggtcagcgaagaggatgcggcgaaggttgagccagtg
ccagacctaaaacgtagaccaaaggctgagccgctggctccgccttcacctgcaaagcggcccgcgccgg
tggcggcgtctactccggcacccgtgccgcgctggaagccgtttatcgccggaatggttaccatgctggc
ggtaacgggtatcgccgtcggcggatggctggcgctgcgtcagtccgacttgccgcccatttcggtcacc
caaaatgccggaccgataccgggcctgccggcgacaacgcccccggggccggttgatctgccacagacgc
agcgccagcttggcgagcttgcccgcctggcgccggactgggcggtcagctacggcgaccagctggtcca
ccatgctcttatccgctggccggatcaggcgcaaccgctggcgcagcagtggcggcagcagctgagtgct
ggcgcattgcccgcggaaaatattaccggctggtcggagggcatgcagcagctgcagcggctcgccgacc
agctcaatgccctcgacgagcagaaggggaagtacctgacggtgagcgaactgaaaaccgcagtatttgc
catcacacagtcgtttaaccgcgctgttccgctggaggagcagctgcgccagctggctgcgcttcccgtt
gatcaaccctggccagccgcgcggggaagcctcgcggagctgcatctgcaacagctgatagtggagtatg
ccctgctgaagcgaaaacagccggcgtcgccgaccgctgcgctccccgcaaccggtgagccctcggtgag
tgaggcggtgaaataa
 Primer design