SecReT6
Protein ID: 597516015
SecReT6 ID898
T6SS typeN/A
Gene symbol-
Locus tagBN49_3356
StrainKlebsiella pneumoniae str. Kp52.145
Repliconchromosome [GenBank: FO834906] [Browse all T6SS(s) in this replicon]
Location [Strand]3479099..3479542 [-]
Product-
NoteTssE
UniProt IDW9BHS4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.40E-16, Aligned region: 26..113
Protein Sequence: 147 a.a.     [Download]
>gi|597516015|ref|CDO15108.1| - [Klebsiella pneumoniae]
MPRPSLYDILYGNFAGGLDLNTVSETDQVILSVLDNMQRILNCRAGTLAHLPDYGLPDMTAVLQGMPASA
HQLMSTLSAVLLKYEPRLQRIAVVMLDQHAPGELRYAIDAELKDIGLVRYGTEFMPEGRVLIRHLKRQQY
LDARSAL
 
Nucleotide Sequence: 444 bp     [Download]
>gi|597516015|emb|FO834906.1|:c3479542-3479099
atgcctcgtccctccctgtatgacatcctgtacggcaatttcgccggcgggcttgacctgaatactgtca
gcgaaacggatcaggtcatcctgtcggtgctcgataacatgcagcgcatcctcaactgtcgggccggaac
gctggcgcatctgccggactacggcctgccggatatgaccgctgtcctccaggggatgccagcgtcggcg
catcagctgatgagcacgttgtcggcggtgttgctgaaatacgaaccgcgcctgcagcggatcgcggtgg
tgatgctcgatcagcatgcgcccggcgaactgcgctatgccattgatgcggagctgaaggatattggcct
ggtgcgttacggcacggagtttatgcccgagggcagggtgttgatccgccacctcaaacgtcagcagtac
cttgacgcccgctccgccctctaa
 Primer design