SecReT6
Protein ID: 597516016
SecReT6 ID898
T6SS typeN/A
Gene symbol-
Locus tagBN49_3357
StrainKlebsiella pneumoniae str. Kp52.145
Repliconchromosome [GenBank: FO834906] [Browse all T6SS(s) in this replicon]
Location [Strand]3479545..3480033 [-]
Product-
NoteTssJ
UniProt IDW9BH97
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.40E-38, Aligned region: 3..153
Protein Sequence: 162 a.a.     [Download]
>gi|597516016|ref|CDO15109.1| - [Klebsiella pneumoniae]
MVTVLTGCGLTQTVKDGAVSVTQSIFYPQVKTLHLDLRAREGVNNNAKGASLATVVRIYQLKDRQAFDNT
DYPSLFAGDGQALQADRVAEKDVRLRPGESVTVDMPMETSAQFVAVAAMFIDPDLTQNSWRLVFTRDELD
PARPRIIEASQNQLTLHPFKEK
 
Nucleotide Sequence: 489 bp     [Download]
>gi|597516016|emb|FO834906.1|:c3480033-3479545
atggttaccgtcttaaccggctgcggactgacgcagaccgtgaaagacggtgccgtttccgtgacccagt
ccattttttacccccaggtgaaaaccctgcatctggatcttcgcgcccgggaaggcgtgaataacaacgc
caaaggcgcctccctggcgacggtggtgcgtatttatcagctgaaggaccggcaagcgttcgacaatact
gactacccgtcgctgtttgccggcgatggccaggcgctgcaggcggaccgggtggcggaaaaagatgttc
gcctgcgtccgggcgaatcggtgaccgtcgatatgcccatggaaaccagcgcgcagtttgtggcggtggc
ggccatgtttatcgatccagacctgacgcaaaacagctggcggctggtattcacccgggacgaacttgat
ccggcgaggccgcgcattatcgaagccagccaaaatcaactgacgctgcacccgtttaaggagaagtga
 Primer design