SecReT6
Protein ID: 597516017
SecReT6 ID898
T6SS typeN/A
Gene symbol-
Locus tagBN49_3358
StrainKlebsiella pneumoniae str. Kp52.145
Repliconchromosome [GenBank: FO834906] [Browse all T6SS(s) in this replicon]
Location [Strand]3480062..3481153 [-]
Product-
NoteTssG
UniProt IDW9BA93
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.20E-81, Aligned region: 23..324
Protein Sequence: 363 a.a.     [Download]
>gi|597516017|ref|CDO15110.1| - [Klebsiella pneumoniae]
MYPVERESQSAPARLMAQLRPQLPYMNFYRFCQLLEKNHPKAPIIGSGWLVGDEPIRFRPHPGMGFPAGE
IRGMDDPEPPRPPAVHVTFMGLYGVESPLPTHYSDDIAQRREGVEATEDFLDIFNHRLIAQYYRIWRKYS
YPATFRAGGTDNISQYLLGLAGLGIPGCAAVAASPLSRFLALLPVMMLPGRSGEGMEALVALLAPGTRAT
VYHHDPCRIPLSQPLTMSVRQPVSLQHRPVMGTHATDVNGQVLLQLATEKPDEVRGWLPGGELFSDLMAL
LHVWLGSHLDVRLQLCVARHLLPDAQLCCQQEHAVQLGRTAVLRPLDAQKQADDRVTIYLGRYQRVRENI
HRRESDEDGDYRS
 
Nucleotide Sequence: 1092 bp     [Download]
>gi|597516017|emb|FO834906.1|:c3481153-3480062
atgtatccggtggaaagagaatcacagtctgcgcctgcccggctgatggcgcagctccggcctcagttgc
cgtacatgaatttttaccgcttctgccagttgctggagaagaaccatccgaaggcgccgatcatcggcag
cggctggctagtaggtgatgaacccatacgctttcgcccgcatccggggatgggctttccggctggcgaa
atccgcggaatggacgatcctgaaccgccccgtccgccggcggttcacgtgacttttatgggactctacg
gcgtggaatccccgctgccgacccactatagcgatgacattgcgcaacggcgggaaggcgtcgaggccac
cgaggatttcctcgatatctttaaccatcggctgatcgcccagtattaccgtatatggcgcaaatattcc
tacccggcaacctttcgggcgggcggcacggacaacatctcgcagtatctgctgggcctggcggggctgg
gcataccgggatgtgccgccgttgccgcatcgccgctgtcgcgatttctggcgctgctgccggtgatgat
gctgccggggagatccggggaaggcatggaggcgctggtggcgctcctggccccggggacccgggcgacg
gtgtaccaccacgatccctgccggatccccttgtcgcagccgttaacgatgagcgtccgtcagccggtta
gcctgcaacataggccagtgatgggaacccacgccacggatgtgaacggtcaggtattgctgcagctggc
cacggaaaagcctgatgaggttcgcggctggctgcccggcggcgaactgttcagcgacctgatggcgctt
ctgcacgtctggctcggatctcatcttgacgtgcggctgcagctttgcgtcgcccgccatttactgccgg
atgcgcaactttgctgccagcaggagcatgccgtccagctcggccgtaccgctgtgctgcgtcctctgga
tgcgcagaaacaggctgacgacagagtcacgatttatctggggcgctatcagcgcgtccgggaaaatatc
caccgcagggagagcgatgaagatggcgattaccgcagttaa
 Primer design