SecReT6
Protein ID: 597516018
SecReT6 ID898
T6SS typeN/A
Gene symbol-
Locus tagBN49_3359
StrainKlebsiella pneumoniae str. Kp52.145
Repliconchromosome [GenBank: FO834906] [Browse all T6SS(s) in this replicon]
Location [Strand]3481108..3482871 [-]
Product-
NoteTssF
UniProt IDW9B9K1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.70E-182, Aligned region: 6..582
Protein Sequence: 587 a.a.     [Download]
>gi|597516018|ref|CDO15111.1| - [Klebsiella pneumoniae]
MDDLTLRYFDAEMRYLREAAKALAQAHPDRAAMLDLDKAGTPDPYVERLFEGFAFSVGRLREKIDDDLPE
LTEGLVSMLWPHYLRTIPSLSIVALTPTLPAMKMAETVPAGFEISSRPLGPKNTVCRYRTTRDLTLNPLA
IEEAVMTAEPDGRSALRLRFACSELADWSQTDLRRLALYLGEDAVTGSALHLWLTRRQAALYLRLPGQTE
RVSLDGYFSPGGFSEEDRLWPKGESAFSGYQLLLEYFTFREKFMFVQLNGLENITLPVGISHFTLEVVFS
EVWQSDLPVSASSLRLHCVPVINLFTLEADPLTISGLESEYLLRPKRLQDGHTEIYSVDSVTGSGRTGEA
RYVPFTRFRHQGGMMRRHAPKRYYHTRVKRGVTGMHDTWLILGGQGWEADRELARETISLRITGTNGQLP
RRALQSTLLDRCESISATPLTVRNLCKPTLPAYPPAEDRYHWRVMSHLGTRFLNMMSSAEVLRGTLSLYN
WREDELNNRRLDAILAVSHHRIQRFEQGFLLRGLDIEVTLDGSGFTGAGDVHLFGDMLNRFFALYADMNQ
FNQLTLIVQPEGKCIRWKENHSLRLPG
 
Nucleotide Sequence: 1764 bp     [Download]
>gi|597516018|emb|FO834906.1|:c3482871-3481108
atggacgatttaaccctgcgatattttgatgctgaaatgcgctacctgcgcgaggcggcaaaagcgctcg
cgcaggctcaccccgatcgggcggcgatgctggatctcgataaagccggtacgccggacccttacgttga
gcgcctgtttgaaggctttgccttttccgtaggtcgcttgcgcgaaaaaattgatgatgatctgccggag
ctgaccgaggggctggtcagcatgctgtggccgcactatttgcgcactattccatcgctatcgatcgtag
cgctgaccccaacgctgccggcgatgaagatggcggaaacggtgcccgccgggtttgagattagctcccg
cccactggggccgaaaaataccgtgtgccggtaccgaaccacccgcgatctgacgcttaacccgctggcg
atagaggaggcggtgatgacggcggagccggacggacgttcggccctgcgactacgattcgcctgtagcg
agctggctgactggtcgcagaccgatctccgccgcctggcgctgtacctgggggaagacgctgttaccgg
cagcgccctccatctgtggctgacccgacgccaggccgcgctgtacctgcgtctgccgggtcagacagag
cgggtaagcctcgacggctatttttccccggggggattcagcgaggaggatcgtttatggccgaaggggg
agagcgctttcagcggctatcagctgctgctcgagtatttcacctttcgcgaaaaatttatgttcgtgca
gctaaatggcctggaaaacatcaccctgccggtggggatatcgcatttcacgcttgaggtggtgttcagc
gaggtctggcaaagtgatttacccgtcagcgcaagcagcctgcgcctgcactgtgtgccggtgattaacc
tgtttacccttgaggccgatccgttgaccatcagcgggctggagagcgaatacctcctgcgtccgaagcg
cctgcaggacgggcataccgaaatctattctgttgacagcgtgaccggctccgggcgcaccggggaggca
cgctatgtgcctttcacccgctttcgtcaccaggggggaatgatgcgtcgccatgcgccgaagcgctact
accacacccgcgtaaaacggggcgtaaccggcatgcacgatacctggcttatcctcggcggacagggatg
ggaggctgaccgggagctggcgcgggaaacgatctccttgcgcatcaccggcactaacggccagctgccg
cgccgggcgctacagagcacgctgctggatcgctgtgagtcgatatcagccacgccgcttaccgtccgca
atctctgtaagcccacgctgccggcctatcccccggcggaagaccgctaccactggcgggtcatgagcca
tctgggcacccgttttctcaacatgatgagcagcgccgaggtgctgcgcggcacgctgtcgctctacaac
tggcgggaggatgagctcaataatcgccgtctggacgccattctggcggtcagccatcaccgaattcagc
gtttcgagcagggcttcctgctgcgcgggctggatatcgaagtgacgctcgacggtagcggatttaccgg
tgcgggcgatgtccacctgtttggcgatatgctcaaccgctttttcgcactgtatgccgatatgaatcag
ttcaaccagctgacgctcattgttcaacctgaagggaaatgtatccggtggaaagagaatcacagtctgc
gcctgcccggctga
 Primer design