SecReT6
Protein ID: 597516019
SecReT6 ID898
T6SS typeN/A
Gene symbol-
Locus tagBN49_3360
StrainKlebsiella pneumoniae str. Kp52.145
Repliconchromosome [GenBank: FO834906] [Browse all T6SS(s) in this replicon]
Location [Strand]3483005..3483811 [-]
Product-
NoteTssM
UniProt IDW9BPL5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1215 [PF06744], Evalue: 5.90E-31, Aligned region: 1..105
Protein Sequence: 268 a.a.     [Download]
>gi|597516019|ref|CDO15112.1| - [Klebsiella pneumoniae]
MEQAWQQVLTPAAESLNAQWRSAVVEDWNSAFGGRYPFKNTSSEVSLPLLAKYLDSETGRIARFLQTRLN
GVLHKEGSRWMADSINAQGLTFNPAFLQAMNTLSHLSDVAFANGEAGLHFALRPGTADGVMQTELVIDSQ
KLVYMNQMPVWRRFSWPADTEAPGASLSWISTRAGTRQYGDFPGAWGWIRLLDKAVVSAYPGTSSSWSLS
WKAPDGLLLNYTLRTEAGEGPLALLALRNFTLPETIFSVRASAERVPLTDDIPGEEGY
 
Nucleotide Sequence: 807 bp     [Download]
>gi|597516019|emb|FO834906.1|:c3483811-3483005
atggaacaggcctggcagcaggtgctgaccccggcggcggaaagtctcaacgcccagtggcgcagcgcgg
tggtggaggactggaatagcgcttttggcggtcgctacccctttaaaaataccagcagtgaagtctctct
gccgctgctggcaaaatacctcgacagcgagaccgggcgcatcgcccgctttctgcagacccggctgaac
ggcgtgctgcataaagaggggagccgctggatggcggacagtatcaatgctcaggggctgacgtttaacc
cggcctttctgcaggcgatgaataccctgagccatctctccgacgtcgcgttcgccaacggcgaagcggg
attgcattttgcgcttcgccccggcacggcggacggcgtgatgcagacggagctggtcatcgacagtcag
aaacttgtctatatgaaccagatgccggtctggcggcggttcagctggcccgctgacaccgaagcgccgg
gcgccagtctgagctggatcagtacccgggcgggcacccgccagtatggcgatttcccgggcgcctgggg
ctggatccgtctgctggataaggcggtggtcagcgcttatcccggaacgagcagcagctggagcctgagc
tggaaagcgccggatggtctgttgctgaactacacgctgcgtaccgaggcgggggaaggaccgctggcgc
tgctggcgctgcgaaactttacgctaccggagacgatattcagcgtgcgcgcgtctgctgaacgtgttcc
gctgaccgacgatatacccggcgaagagggatactga
 Primer design