SecReT6
Protein ID: 597516022
SecReT6 ID898
T6SS typeN/A
Gene symbol-
Locus tagBN49_3363
StrainKlebsiella pneumoniae str. Kp52.145
Repliconchromosome [GenBank: FO834906] [Browse all T6SS(s) in this replicon]
Location [Strand]3487766..3488029 [-]
Product-
NotePAAR
UniProt IDW9BA97
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 6.3e-29, Aligned region: 5..80
Protein Sequence: 87 a.a.     [Download]
>gi|597516022|ref|CDO15115.1| - [Klebsiella pneumoniae]
MKGIIRTGDTHTGGGKVLRGSSNMKFGGIGVARLGDPVSCPIKGHGPTVIAEGHPTFSDHGIPVAFHGHR
CACGCILLSSLPQARVR
 
Nucleotide Sequence: 264 bp     [Download]
>gi|597516022|emb|FO834906.1|:c3488029-3487766
atgaaaggaattattcgtacaggcgatacgcataccgggggcgggaaagtgctccgtggttccagtaata
tgaaatttggtggtatcggcgtggcgcggctgggcgatcccgtcagttgtccgatcaaaggccatggtcc
gacggtgattgccgaagggcaccccacttttagcgatcatggtataccggttgcgttccatggccaccgt
tgtgcttgtggttgcatattgctgtcgagcctgccacaagccagggtgcgctaa
 Primer design