SecReT6
Protein ID: 597516032
SecReT6 ID898
T6SS typeN/A
Gene symbol-
Locus tagBN49_3373
StrainKlebsiella pneumoniae str. Kp52.145
Repliconchromosome [GenBank: FO834906] [Browse all T6SS(s) in this replicon]
Location [Strand]3498991..3501690 [-]
Product-
NoteTssI
UniProt IDW9BAA4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.80E-64, Aligned region: 35..355
Phage_GPD [PF05954], Evalue: 3.80E-64, Aligned region: 596..640
DUF2345 [PF10106], Evalue: 5.20E-47, Aligned region: 612..760
T6SS_Vgr [PF13296], Evalue: 1.60E-34, Aligned region: 487..592
T6SS_Vgr [PF13296], Evalue: 1.60E-34, Aligned region: 593..620
Phage_base_V [PF04717], Evalue: 1.50E-15, Aligned region: 387..482
Nsp1_C [PF05064], Evalue: 0.004, Aligned region: 33..55
Nsp1_C [PF05064], Evalue: 0.004, Aligned region: 579..622
Protein Sequence: 899 a.a.     [Download]
>gi|597516032|ref|CDO15125.1| - [Klebsiella pneumoniae]
MDTSSIITGTTLNRYQLDIPSCAASLDVEEFSGAEKLSELYYYTITFTSAEKNIDAAQLLSKPAMLTMGG
GALQQLADCKRVHGVITTFRRVNRSEDQSTYQITLQPFLSLLDKQFRSHRFFVNKSVPEVVEQVLQEHHL
HDWEYEFNLKQHYPRREQINQYQESDLAFIQRLLAEVGIFYFFTLQEEAQSEVVHFADAQRALMFDKTLP
VNSPSGMSDSGAESIWGLSITHNVVEANVTTRDYNPRDAQSVLQSATADMTRGNGEGITYGEVYHYKLRH
RERGDKIEPQTETANFYARLDHERFLAHQTLITASSTAAWLAPAQVLTVTDSLPSTLPAPVQDPLLITGT
GFTASRREALRVSLLAVPYSETLCWRPPLLPRPKVTGTMTARVTSAKANDIYAWQDASGLYRVKFDADRD
EKGQGQESMPVRLAKPYGGDVYGFHFPLIQGTEVAIAFHEGDPDRPYIAHALHDSRHVDPVTEKNSTRNV
IRTPANNKLRMEDKRGEEHIKLSTDYGGKTQLNLGHNVNAQRELRGEGFELRTDKWGAIRAGKGIFITAD
KQSTASGKILAMQDTLDRLKQAGDEMDSLSRDAQSAKADPAQVEQQLAFMREQIDQLREAVAVLSAPNGV
ALASGKHLQLTARRNLMLNAGADADMGVMKRLFIGVGEGLSLFVRKLGMKLIANQGPVAIQAQNDQLQLL
ARKELEIVSTDSEIHIVAKKKIIINAGGSYITLDPYRIELGTGGDVDVKAADFSYSGPASMKADHPDYPP
LQSTVRQSLKLNVAQSPNASDSSWAGMPYTLYADGALLKQGVLDERGQISVDHQVVTRSYKLEMANGVSY
QIPVAEAYSRPEQGELANRGFHHHTSQAASDINPPSSHTEHRNTYADLLDGHIEQDESQ
 
Nucleotide Sequence: 2700 bp     [Download]
>gi|597516032|emb|FO834906.1|:c3501690-3498991
atggatacctcttcaataattaccggcaccacccttaaccgttaccagctggatattccttcatgtgccg
catcgctggatgtggaagaattcagtggggcagaaaaactgagtgaactttattattacactattacgtt
taccagcgcagagaaaaatattgatgccgcacagctcctgagcaaacccgccatgctgacgatgggcggc
ggcgcactgcagcagttggcggactgcaaacgcgtccatggtgtgattaccaccttccggcgcgtcaatc
gttctgaagatcagtcgacctatcagataaccctccagccgtttctctccctgctggataaacagtttcg
cagccaccgttttttcgtcaacaaatcggtgccggaggtggtggagcaggtattgcaggaacatcacctg
catgactgggagtatgagtttaatctcaagcaacactatccgcggcgcgagcaaattaatcagtatcagg
agagcgacctggcatttatccagcgcctgctggcagaggtggggatattttatttcttcaccctgcagga
agaggcgcagagcgaagtggttcacttcgccgacgcgcagcgggcgctgatgttcgataagacacttcct
gtaaacagcccgtccgggatgagcgacagcggtgcggaatcgatatggggtctgagcatcacccacaacg
tcgtagaggcgaacgtcactacccgggattataacccccgcgatgcgcagagcgttctccagtcggcaac
agcggatatgacccggggaaatggtgaaggcatcacttacggtgaggtataccactataagcttcgccac
cgggagcgtggcgataaaatcgagccgcagacggagaccgccaacttttatgcccgcctcgaccatgagc
gttttctggctcaccagacgcttattaccgcgagcagtactgcagcctggctggcgccggcccaggtgct
gaccgttaccgacagcctgccgtcgaccctgcctgcgcccgtacaggatccgctgttaatcaccggcacc
ggttttaccgccagccgccgggaggcgctgcgggtgtccctgctggcggtgccctacagcgaaacattgt
gctggcgtccgccgctgctgccgcgcccgaaggtgactggcaccatgacggcgcgggtgaccagcgcgaa
agcgaatgatatctacgcctggcaggatgcgtccggcctgtaccgggtgaaatttgacgctgacagagat
gagaaagggcagggtcaggaaagcatgccggtgcgtctcgccaaaccctacggcggcgacgtgtacggct
ttcacttcccgctgatccagggcacggaggtggcgattgctttccacgaaggcgaccctgaccggccgta
tattgcgcatgcgctgcacgactcgcggcatgtcgatcctgtgacggagaaaaacagcacccgcaatgtg
attcgtactccggccaataataagctgcgaatggaggacaagcgcggcgaggagcatatcaagctcagca
ccgattacggcggcaagacgcagctgaacctggggcataacgtgaatgcgcaaagggagttgcggggcga
ggggtttgagctccggacggataaatggggggcgatacgggcggggaaagggatctttatcaccgcagat
aaacagtcaaccgccagcggcaagatacttgcaatgcaggataccctggacaggcttaagcaggcaggtg
atgagatggactcgctatcgcgtgatgcccagtcggctaaagccgacccagcccaggttgaacaacagtt
agcttttatgcgtgagcaaattgatcagctacgggaggcggttgccgtgctcagcgcaccaaatggtgtg
gctctcgccagtggcaagcatctgcaactaaccgcacgtcgcaatctgatgctcaatgccggggcagatg
ccgatatgggcgtaatgaaacggctgtttattggcgtgggggaagggctgagcctgtttgtccgcaagct
ggggatgaaattaatcgccaatcaggggcccgtggcgattcaggcgcaaaacgatcagttgcagctcctg
gcgcgcaaggagctggagattgtcagtactgatagcgaaattcacattgtggcaaagaaaaaaatcatca
ttaacgctggaggaagctatatcaccctcgatccctatcggattgagctcggtactggcggtgatgtcga
cgtcaaagccgcggatttttcctatagcggacccgccagcatgaaggccgatcatccggattatccgcca
cttcagtccaccgtaaggcaatcgctgaaactgaacgtggcacagtcgccaaatgcgtcggacagcagct
gggccggaatgccatataccctgtatgccgatggcgcattgttgaaacaaggggtgctggatgaaagagg
tcagatatcagtcgatcaccaggtcgtgaccagaagttacaagctggagatggctaatggcgtcagctat
cagatacccgttgccgaagcgtacagtcgccctgagcagggggaactcgctaatcgcggctttcaccacc
atacctcgcaggctgcatctgatattaaccccccctcctcacatacggagcaccgtaatacttacgcgga
tttgctcgatggccatattgaacaggacgaaagtcaatga
 Primer design