SecReT6
Protein ID: 597516033
SecReT6 ID898
T6SS typeN/A
Gene symbol-
Locus tagBN49_3374
StrainKlebsiella pneumoniae str. Kp52.145
Repliconchromosome [GenBank: FO834906] [Browse all T6SS(s) in this replicon]
Location [Strand]3502149..3503846 [-]
Product-
NoteTagL
UniProt IDW9B9L5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 2.6e-21, Aligned region: 345..531
Protein Sequence: 565 a.a.     [Download]
>gi|597516033|ref|CDO15126.1| - [Klebsiella pneumoniae]
MRDNARRLLTILTVILALWLVLGFWPLSIGNQLIFSLCILLAGGAALWRQRRRAVSRQRSEIVLPPEDFQ
GAVVLVCGDTDGLFPGRSAHGETRHGWYLRGDSAEQLPRLAQYLAAARPALVSQVSVLLAVVPEHHPSGE
HLAQSLRDWRRSIVQCRTWLNGLPPVWSVFWVTPPGGQAAESRWFTITPERAGLQVQQKGQAPQSVAGWQ
REGSPASRLHQTLWLESILSLAENALFRPFRARQAELPPLNLCAAGICLTPVAAVANNLWQQQIAGITTL
SPGNDAAPGPHPLPDLLLSSLPHRHGVSRRIRDAGLAAGVGFLFLALAMLASFINNQRLVRSVGDHLAVY
HRLSGTPPTPKLQAQQRLRADSRLLDDWLRRGEPLRYRLGLYQGGRLIPFVEAAINDWAPPPPPRPVIKQ
VVQGPQTIRLDSMALFDTGKSALKPGSTKLLVNSLLGIKAKPGWLIVVAGHTDSIGNDKSNQQLSLKRAE
AVRDWMRDTGDVPESCFAVQGYGASRPVASNETPEGRAQNRRVEISLVPQKDACLTPGTANTSGAETNGL
KSETE
 
Nucleotide Sequence: 1698 bp     [Download]
>gi|597516033|emb|FO834906.1|:c3503846-3502149
atgcgtgataacgcccgtcgtctgcttacgatactgaccgtcatcctggccctgtggctagtgctgggct
tctggccgctgtccatcggcaaccagctgatcttcagtctgtgcatcctgctggcgggcggcgcggcgct
ctggcgtcagcgtcgccgggcagtcagccgtcagcgatcggaaatcgtcctgccgcccgaggattttcag
ggggcggtggttctggtctgcggggataccgacggtctgtttcccgggcgttcggcgcacggcgaaaccc
gtcacggctggtatctccggggtgacagcgcggagcagttgccgcggctggcgcagtacctggcggcggc
gcgtccggcgctggtatcgcaggtttccgtgctgctggcggtggtaccggagcaccacccctccggggag
catctggcgcagtcgctgcgcgactggcggcggagtatcgttcagtgccgaacctggctaaacggtctgc
cgccggtgtggagcgtgttctgggtgacgccgccaggcggccaggccgcggaaagccgctggtttaccat
cacgccggagagggctggtctccaggtgcagcagaagggacaagcgccccagtcggttgccgggtggcag
cgggagggcagccctgcctcacgcctgcatcagacgctgtggctggagagcattctgtccttggccgaaa
acgctctgttccggccattccgcgcccggcaggcggaacttcctccgctgaacctgtgtgccgcgggcat
ctgcctgacaccggtagcggcggtggcgaataacctctggcaacagcaaatcgccgggatcaccacgctc
tccccgggcaacgacgcggcgccaggtcctcacccgctgccggatcttcttctgtcgtcactgccgcacc
gccacggggtcagccgccggatacgcgatgccggtcttgccgctggggtgggcttcctctttctggcgct
ggcgatgctggcttcctttatcaacaaccagcgcctggtgcgcagcgtcggcgatcatctggcggtgtac
caccgcctcagcggcacgccgccgacgccgaagctgcaggcgcagcagcgtctgcgtgccgacagccgcc
tgctggatgactggttgcgccggggggagccgctgcgttatcggctggggctgtatcagggggggcggct
gatccccttcgtggaagccgctatcaatgactgggcgccgcccccgccgccgcgtccggtcattaagcag
gttgtgcaggggccgcagacgatccgcctcgatagcatggcgctgttcgataccggcaaatcggcgctga
aaccgggttcgacaaagctgctggtgaactcgctgctgggcattaaggcgaaacccggctggctgatcgt
ggtggcaggccataccgacagcatcggcaacgataaatccaatcaacaactctccctgaagcgtgccgag
gcggtccgcgactggatgcgcgataccggcgatgtgccggagagctgttttgcggtgcagggctacggcg
caagccgtcctgtcgccagcaacgagacgccagaggggcgggcgcaaaatcgccgggtggagatcagtct
ggtcccgcagaaggacgcctgtctgacgccgggcacggccaatacctcaggagcagagactaacggatta
aaaagcgaaaccgagtaa
 Primer design