SecReT6
Protein ID: 597516034
SecReT6 ID898
T6SS typeN/A
Gene symbol-
Locus tagBN49_3375
StrainKlebsiella pneumoniae str. Kp52.145
Repliconchromosome [GenBank: FO834906] [Browse all T6SS(s) in this replicon]
Location [Strand]3503850..3504503 [-]
Product-
NoteTssL
UniProt IDW9BPL8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.00E-41, Aligned region: 10..205
Protein Sequence: 217 a.a.     [Download]
>gi|597516034|ref|CDO15127.1| - [Klebsiella pneumoniae]
MNTSESDLINKTFYPGWLMVSQLRCGQPVTDGEALYRQACRWVTEAREALTAGGVSEASAEQMLYAYCAL
LDESVLNRASQDDGYRRWRKDPLQARFFSTLNAGEELWERIRQLLREPTADAAVLTCFFRTLQLGFVGQY
RAEDDERREDVAQALGARVPPFSLTQEAPVVVRASRLRSGRRMYWCGWAAGIVALAALWLTCSAMLSQMV
AQIAGQG
 
Nucleotide Sequence: 654 bp     [Download]
>gi|597516034|emb|FO834906.1|:c3504503-3503850
atgaatacctctgaaagcgatctgatcaacaaaactttttacccgggctggctgatggtcagccagttac
gctgcggccagccggtgacagatggcgaggcgctctatcgccaggcctgtcgatgggtgaccgaggcgcg
cgaggcgctgacggcggggggagtcagtgaagccagcgctgagcagatgctctatgcctactgcgcgctg
ctcgatgagagcgtcctcaaccgcgccagtcaggatgatggctaccgcaggtggcgcaaggatccgctgc
aggcgcgctttttcagcactctcaacgccggggaagagctctgggaacggatccgccagctgctgcgaga
gcccacggcggatgcggcagtgctgacctgcttctttcgtactttacagctgggatttgtcggacagtac
cgcgccgaggatgacgaacggcgtgaggacgtggcgcaagcgcttggcgcgcgggtcccgccgttcagcc
tgacccaggaggcgccggtggtggttcgtgcctcccggctgcgcagcggacggcggatgtactggtgcgg
ctgggcggccggcattgtggcgctggcggcgctgtggttgacctgctccgccatgctgtcacagatggtg
gcgcagatagcagggcagggataa
 Primer design