SecReT6
Protein ID: 597516035
SecReT6 ID898
T6SS typeN/A
Gene symbol-
Locus tagBN49_3376
StrainKlebsiella pneumoniae str. Kp52.145
Repliconchromosome [GenBank: FO834906] [Browse all T6SS(s) in this replicon]
Location [Strand]3504500..3505840 [-]
Product-
NoteTssK
UniProt IDW9BHT4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.60E-129, Aligned region: 18..443
Protein Sequence: 446 a.a.     [Download]
>gi|597516035|ref|CDO15128.1| - [Klebsiella pneumoniae]
MKIFRPLWRDGAFLVPQQFQQQARWDAYVADTVSRMALAHPWGVLRAEFDASALTLSRLNATRLIVRFAD
GTLIDTELADILPPVRDVSDVMQDSVEVLLALPLLSASGGNLDDGQESARPRRWRAEQVTVQELAGHERS
ELAVLRHALTLRLSTEENAAFLTCPVARLVRDAQGQWIVDPEFIPPLLSLAASPTLVSELGELLHRLQAR
RRRLMAMRRESNARMADFAVADVSLFWLLNALNSAEPVLSELHLDPSRHPELLYRELARLAGSLLTFSLE
HHLEAIPRYRHASPEQVFPPLFALLDTLLEVSLPSRVIAIVLEQGADREIWRGRLHDARLREGADFYLSV
RSSLPPHQLQSRFPQLCKAGSHDDVAEVVNIALSGIAIKPLSHVPAAIPLRLENQYFALDLSTDAARAML
EAGNCTFYTPESLGDVKLELFAVLRS
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|597516035|emb|FO834906.1|:c3505840-3504500
atgaagattttccgcccattatggcgcgacggggcttttctggtcccgcagcagtttcagcaacaggccc
gctgggacgcgtacgtcgccgatacagtctcccgcatggcgctcgcccacccgtggggggtattgcgcgc
ggagtttgacgcgagcgcgctcaccctttcccggctcaacgctacccggctgatcgtgcgtttcgccgac
ggaacgctgattgacaccgagctggcggatattttgccaccggtccgcgatgtatcggacgtgatgcagg
acagcgtggaggttctgctcgctctgccgctgctcagcgccagcggcggcaatcttgatgacggccagga
gagcgcccgcccgcgccgctggcgcgccgagcaggtgaccgtccaggagctggccggccatgaacgcagc
gagctggccgttctgcggcacgcgctaacgctgcgtctctccaccgaggaaaatgcagccttcctcacct
gcccggtagcgcgtctggtgcgcgacgcccaggggcagtggatcgttgacccggaattcatcccgccgct
gctgtcgctggcggcaagcccgacgctggtcagcgagctgggcgagctgttacatcgcctgcaggcccga
cgcagacgcctgatggccatgcgtcgtgaaagcaatgcgcggatggctgattttgccgtggcggatgttt
ccctgttctggctgctcaacgcgctgaacagcgctgaaccggtgctcagcgagctgcatctggatccctc
gcgccatccggagctgctttatcgcgaactggccaggctggccggcagtctgctgactttctcccttgaa
catcatctggaagcaatcccccgctaccggcatgcctcgccagagcaggtattcccaccgctgtttgccc
tgctggatacgctgctcgaagtcagcctgccctcaagggtgatcgccatcgttctggagcagggcgccga
ccgggagatctggcggggcaggctgcacgatgcgcggctgcgcgagggggcggatttttatctgtcggtg
cgctcttcactcccccctcaccagctacagagccgctttccgcagctctgtaaggcgggtagccatgatg
atgtcgccgaggtcgtcaatattgccctcagcggcatcgcgatcaaaccgctgagccatgtgccggcggc
cattccgctacgtctggaaaaccaatatttcgctctggatctctccaccgatgccgcccgcgcgatgctg
gaggccggcaactgcaccttctataccccggaatcgcttggcgacgtgaaacttgaactctttgcggtac
tgcgctcatga
 Primer design