SecReT6
Protein ID: 611963692
SecReT6 ID904
T6SS typei2
Gene symbolxmoN
Locus tagxmoN
StrainEscherichia coli strain TW-XM
Repliconchromosome [GenBank: KF678349] [Browse all T6SS(s) in this replicon]
Location [Strand]16388..19741 [+]
ProductIcmF-like protein
NoteTssM
UniProt IDX5F6I7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.30E-66, Aligned region: 400..717
IcmF-related [PF06761], Evalue: 2.30E-66, Aligned region: 779..822
DUF1215 [PF06744], Evalue: 1.50E-35, Aligned region: 434..467
DUF1215 [PF06744], Evalue: 1.50E-35, Aligned region: 840..959
Protein Sequence: 1117 a.a.     [Download]
>gi|611963692|ref|AHW84492.1| IcmF-like protein [Escherichia coli]
MHTQRYGFWGYLILIIGLAGICALLIIINQDVLIKSGVSARLIWGIWAGLFSLFLLGVVCSPFWWIRKQR
KAQFIYRPKNSAENDQPVSSPSEDILTDLSSNIRLRYGPFWRRKVRLLLVTGEPEEAEAIAPGLTGQHWL
EGDHTVLIYGGRPTAEPDVTLLTALKKLRRSRPLDGIIWPLTEEQSRQTAQLDKGWRELINGGKRLGFQA
PLYLWQVCDDGDYQTGRPLQSVGCLLPERCTPEQLAVMLEAQTLPLTEQGMSQLLADNRHDFLLRLAHTL
AERGIAHWQSVLKPLLAGGAFSSLRLRGLMFSPPLAAVPEAAPHAWLPSPVWAGVTGDNARGRTVGFPWL
RTALMSAVCVLVIWGAGMTTSFFANRALVQETGIQTARALDTRLPLAEQLVALHTLQGELERLQYRIREG
APWYQRFGLERNQQLLAAAFPGYAQAANRLVRDVAVDHLQQQLNAFVALPPNSPQRTATGEQRYKQLKAL
LMTSRPEKADAAFFSTTLMADGLRYENIPEGVRQSVLPSLLTFWTANLPEHPQWKTSPPPELTGAVRKIL
LRQIGVRNAENTLYQNVLQQVSRNYADMTLADMTGDTLTESLFSTEQTVPGMFTRQAWEGQVREAIEQVV
TARREEIDWVLSDRQQDTSADISPDTLRNRLTSRYFTDFAGSWLAFLNSIRWKKEDSLSGILDQLTLMAD
ARQSPLIALTDTLAWQAAAGRENRGLSDSLAKSAQELFNGKEKTPQQSREGNEPVGPLDKTFAPLLRLLG
DKAGGGGGDTQLSLQTYLTRVTRVRLKLQQVTNAPDPQEMTQQLAQTVLQGKTVDLTDTRDYGRLIAASL
GEEWSGFGQALFVRPVEQSWRQVLTPAADSLNRQWQRAIVSHWNQDFAGRYPFKASQNDASLPLLAQYLR
DDGRINQFIAANLSGVLKREGRYWVADAMNTQGLTVNPDFIRALNRLRDVADTAFASGDAGIHFELRAKP
ARDVMKTHLVIDGQELEYFNQKERWQRFNWPDEQWQPGASLSWTSTQAMERILADYRGSWSLIRLLEQAQ
VTPVDSSTFKVVWKAQDGLPLNYLLRVEQGKGPLALLELKNFRLPGQVFLTGRSMKDAEEYGEDADE
 
Nucleotide Sequence: 3354 bp     [Download]
>gi|611963678|gb|KF678349|xmoN|:16388-19741
ATGCATACTCAGCGTTACGGTTTCTGGGGATATTTAATTCTGATTATTGGTTTGGCAGGGATTTGCGCTC
TGTTAATTATTATTAATCAGGATGTTCTGATAAAGAGCGGAGTGTCTGCTCGTCTGATATGGGGAATATG
GGCGGGATTATTTTCTCTTTTTTTACTTGGGGTTGTGTGTTCGCCGTTCTGGTGGATCCGGAAGCAAAGG
AAAGCGCAATTTATTTACAGACCAAAAAATTCGGCAGAAAACGACCAACCCGTATCTTCTCCATCAGAGG
ATATTTTAACCGATCTCAGCTCAAATATTCGGTTACGCTATGGTCCGTTCTGGCGGCGTAAAGTCCGCCT
GCTGCTGGTGACCGGCGAGCCTGAAGAGGCAGAGGCCATCGCGCCGGGGCTGACCGGGCAACACTGGCTG
GAGGGCGACCACACCGTGCTGATATATGGCGGCAGGCCAACAGCGGAGCCTGATGTCACACTGCTGACCG
CCTTAAAAAAACTGCGCCGCAGCCGTCCGCTGGACGGCATCATCTGGCCGCTGACAGAAGAACAAAGCCG
CCAGACCGCACAACTCGACAAAGGCTGGCGCGAACTGATAAACGGCGGTAAGCGACTCGGTTTTCAGGCT
CCACTCTATTTGTGGCAGGTCTGTGACGACGGTGATTATCAGACCGGACGCCCCCTGCAAAGCGTCGGCT
GCCTGCTGCCGGAACGCTGTACCCCGGAACAACTGGCTGTAATGCTGGAAGCACAAACCCTGCCGCTGAC
GGAACAGGGCATGTCGCAACTGCTGGCGGATAACCGCCATGATTTCCTGCTGCGTCTGGCCCATACCCTT
GCAGAGCGGGGTATCGCTCACTGGCAAAGCGTTCTGAAACCGCTGCTGGCAGGCGGCGCATTTTCTTCCC
TGCGCCTGCGTGGCCTGATGTTCAGCCCGCCGCTTGCCGCCGTGCCGGAGGCCGCACCTCATGCGTGGCT
GCCGTCACCGGTCTGGGCGGGCGTGACGGGTGATAACGCGCGCGGGCGCACGGTGGGTTTTCCGTGGCTG
CGTACCGCACTGATGTCCGCTGTCTGCGTGCTGGTGATATGGGGGGCCGGAATGACGACCTCGTTCTTCG
CCAACCGCGCTCTTGTTCAGGAAACCGGTATCCAGACGGCGCGTGCGCTCGATACCCGCCTGCCGCTGGC
AGAACAACTGGTGGCGCTGCATACCCTGCAGGGCGAACTGGAACGCCTGCAATACCGTATCCGCGAAGGT
GCGCCGTGGTATCAGCGTTTTGGCCTTGAACGTAACCAACAACTGCTCGCCGCCGCTTTTCCCGGCTATG
CGCAGGCGGCAAACCGGCTGGTGCGCGACGTGGCCGTTGACCATCTGCAACAGCAACTTAATGCCTTTGT
CGCGCTGCCGCCCAACAGTCCTCAGCGTACCGCCACCGGTGAACAACGCTATAAGCAGCTTAAGGCATTG
CTGATGACTTCCCGCCCGGAAAAGGCCGACGCTGCCTTTTTCAGTACCACGCTGATGGCGGACGGTCTGC
GCTACGAGAATATCCCGGAAGGTGTGCGGCAGAGCGTGTTGCCGTCACTGCTGACCTTCTGGACGGCGAA
CCTGCCGGAACACCCGCAGTGGAAAACATCGCCGCCACCGGAACTGACCGGCGCAGTGCGTAAAATCCTG
CTGCGCCAGATTGGTGTGCGTAATGCCGAAAACACCCTCTACCAGAACGTGCTGCAACAGGTGTCCCGCA
ACTACGCCGATATGACGCTGGCGGACATGACCGGGGATACCCTCACCGAATCTCTTTTCAGTACGGAACA
GACGGTGCCGGGGATGTTCACCCGTCAGGCGTGGGAAGGACAGGTCAGGGAAGCCATCGAGCAGGTGGTG
ACGGCGCGGCGCGAGGAAATCGACTGGGTACTCAGCGACCGCCAGCAGGATACCTCTGCGGATATCTCGC
CGGATACGCTGCGTAACCGTCTCACCTCACGCTACTTTACCGACTTTGCCGGAAGCTGGCTGGCGTTTCT
CAACAGCATTCGCTGGAAAAAGGAAGACTCGCTCTCCGGCATTCTCGACCAGCTGACACTGATGGCCGAT
GCCCGTCAGTCGCCACTGATTGCGCTGACGGACACCCTCGCGTGGCAGGCGGCGGCAGGCAGGGAAAACC
GTGGCCTGTCAGACTCGCTGGCGAAATCGGCACAGGAACTGTTTAACGGCAAGGAGAAAACGCCGCAGCA
ATCCCGTGAAGGCAACGAGCCTGTCGGGCCGCTGGATAAAACCTTCGCGCCGCTACTGCGGTTGCTGGGC
GATAAGGCAGGAGGCGGTGGTGGTGATACGCAACTCAGCCTGCAAACGTATCTGACCCGCGTCACCCGCG
TGCGTCTCAAACTGCAACAGGTGACCAACGCCCCCGACCCGCAGGAGATGACCCAGCAACTGGCGCAGAC
GGTTTTACAGGGCAAAACCGTTGACCTCACCGACACCCGCGACTACGGACGGTTAATCGCCGCCAGTCTG
GGCGAGGAATGGAGTGGCTTCGGTCAGGCGCTGTTCGTCCGCCCGGTGGAGCAGTCGTGGCGGCAGGTGC
TGACGCCTGCGGCGGACAGCCTGAACCGTCAGTGGCAGCGGGCGATAGTCAGCCACTGGAATCAGGACTT
CGCCGGGCGCTATCCGTTCAAAGCCTCACAAAACGATGCCTCTCTTCCCCTGCTGGCACAGTATCTGCGC
GATGACGGGCGCATCAACCAGTTTATCGCCGCCAACCTTTCCGGTGTTCTGAAACGTGAAGGCCGCTACT
GGGTGGCTGACGCCATGAACACGCAGGGGCTGACGGTTAACCCGGACTTTATCCGCGCCCTGAACCGCCT
GCGTGACGTGGCCGACACCGCCTTTGCCAGCGGCGATGCGGGAATACATTTCGAACTGCGGGCAAAACCG
GCGCGTGACGTGATGAAAACGCATCTGGTGATTGACGGGCAGGAGCTGGAATATTTCAACCAGAAGGAAC
GCTGGCAGCGTTTCAACTGGCCGGATGAACAGTGGCAACCCGGCGCATCGCTGAGCTGGACCAGCACGCA
GGCGATGGAACGCATTCTGGCGGATTACCGGGGAAGCTGGAGCCTTATTCGCCTGCTGGAACAGGCGCAG
GTGACACCGGTGGACAGCAGCACCTTTAAGGTGGTGTGGAAAGCGCAGGATGGCCTGCCGCTGAATTACC
TGCTGCGGGTTGAACAGGGTAAAGGGCCGCTGGCGCTGCTGGAGCTGAAAAACTTCCGCCTGCCGGGACA
GGTATTTCTGACCGGCAGGAGTATGAAGGATGCGGAAGAGTATGGGGAAGACGCCGATGAGTGA
 Primer design