SecReT6
Protein ID: 611963705
SecReT6 ID905
T6SS typei1
Gene symbolxmtC
Locus tagxmtC
StrainEscherichia coli strain TW-XM
Repliconchromosome [GenBank: KF678350] [Browse all T6SS(s) in this replicon]
Location [Strand]1867..5334 [-]
ProductIcmF-like protein
NoteTssM
UniProt IDQ6TKT8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 5.40E-83, Aligned region: 487..800
ImcF-related_N [PF14331], Evalue: 9.80E-60, Aligned region: 190..437
ImcF-related_N [PF14331], Evalue: 9.80E-60, Aligned region: 817..863
DUF1215 [PF06744], Evalue: 3.90E-32, Aligned region: 285..303
DUF1215 [PF06744], Evalue: 3.90E-32, Aligned region: 896..1014
Protein Sequence: 1155 a.a.     [Download]
>gi|611963705|ref|AHW84504.1| IcmF-like protein [Escherichia coli]
MPRFKVSATWLLTLAWIFLLVWIWWQGPKWTLYEQHWLAPLANRWLATAVWGLIALVWLTWRVMKRLQKL
EKQQKQQREEEKDPLTVELHRQQQYLDHWLLRLRRHLDNRRYLWQLPWYMVIGPAGSGKSTLLREGFPSD
IVYTPESIRGVEYHPLITPRVGNQAVIFDVDGVLTTPGGDDLLRRRLREHWLGWLMQTRARQPLNGLILT
LDLPDLLTADKSRRETLVQNLRQQLQEIRQSLHCRLPVYVVLTRLDLLNGFAALFHSLDKKDRDAILGVT
FTRRAHESDGWRSELGAFWQTWVQQVNLALSDLVLAQTGAAPRSAVFSFSRQMQGTGEIVTALLAALLDG
ENMDVMLRGVWLTSSLQRGQVDDIFTQSAARQYGLGNSSLATWPLVETTPYFTRRLFPEVLLAEPNLAGE
NSVWLNSSRRRLTAFSTCGAALAALMVGSWHHYYNQNWQSGVNVLAQAKAFMDVPPPQGTDEFGNLQLPL
LNPVRDATLAYGDYRDHGFLADMGLYQGARVGPYVEQTYIQLLEQRYLPSLMNGLIRDLNIAPPESEEKL
AVLRVVRMMEDKSGRNNEAVKQYMARRWSNEFHGQRDIQAQLMVHLDYALEHTDWHAQRQSSDSDAVSRW
TPYDKPIINAQQELSKLPIYQRVYQTLRTKALSVLPADLNLRDQVGPTFDNVFVAGNDEKLVIPQFLTRY
GLQSYFVKQREGLVELTALDSWVLNLTQSVAYSEADREEIQRHITEQYISDYTATWRAGMDNLNVRDYEA
MSALTDALEQIISGDQPFQRALTALRDNTHALTLSGKLDDKAREAAINEMDYRLLSRLGHEFAPENSALE
EQKDKASTLQAVYQQLTELHRYLLAIQNSPVPGKSALKAVQLRLDQNSSDPIFATRQMAKTLPAPLNRWV
GKLADQAWHVVMVEAVRYMEVDWRDNVVKPFNEQLADNYPFNPRATQDASLDSFERFFKPDGILDNFYKN
NLRLFLENDLTFGDDGRVLIREDIRQQLDTAQKIRDIFFSQQNGLGAQFAVETVSLSGNKRRSVLNLDGQ
LVDYSQGRNYTAHLVWPNNMREGNESKLTLIGTSGRAPRSIAFSGPWAQFRLFGAGQLTNVTSDTFNVRF
NVDGGAMVYQVHVDTEDNPFTGGLFSLFRLPDTLY
 
Nucleotide Sequence: 3468 bp     [Download]
>gi|611963702|gb|KF678350|xmtC|:1867-5334
ATGCCGCGGTTTAAAGTTTCCGCCACCTGGCTACTGACGCTGGCATGGATTTTTCTGCTGGTGTGGATCT
GGTGGCAGGGTCCAAAATGGACGCTCTATGAGCAGCACTGGCTGGCTCCGCTGGCAAACCGCTGGCTGGC
GACCGCCGTCTGGGGACTTATCGCTCTGGTCTGGCTCACCTGGCGGGTGATGAAGCGTCTGCAAAAGCTG
GAAAAACAGCAGAAACAGCAGCGGGAGGAAGAAAAAGATCCGTTGACCGTGGAACTCCACCGCCAGCAGC
AATATCTGGATCACTGGCTGCTGCGCCTGCGCCGCCATCTGGATAACCGCCGTTATCTGTGGCAGTTGCC
GTGGTATATGGTCATTGGTCCTGCGGGTAGCGGCAAAAGCACGCTGCTGCGCGAGGGCTTTCCGTCTGAC
ATTGTTTACACGCCGGAAAGCATCCGGGGTGTGGAATACCACCCGCTGATCACACCGCGAGTGGGCAACC
AGGCGGTAATTTTCGATGTTGACGGCGTACTGACCACTCCCGGCGGGGATGATCTGCTCCGCCGCCGCCT
GCGCGAACACTGGCTGGGCTGGCTGATGCAAACGCGCGCTCGCCAGCCGCTCAACGGTCTTATCCTGACG
CTCGATCTTCCCGATCTGCTGACGGCGGATAAATCCCGCCGTGAGACACTGGTACAAAATTTGCGCCAGC
AACTTCAGGAGATCCGTCAGAGCCTGCACTGCCGTCTGCCCGTTTACGTGGTGCTGACACGGCTGGATCT
GCTGAACGGCTTTGCCGCGCTGTTCCATTCACTGGATAAAAAAGACCGCGATGCGATCCTCGGCGTCACA
TTTACCCGCCGCGCCCATGAAAGTGACGGCTGGCGCAGCGAACTGGGGGCTTTCTGGCAGACGTGGGTAC
AACAGGTGAACCTGGCGCTGTCGGATCTGGTGCTCGCACAAACCGGTGCTGCTCCCCGCAGCGCTGTGTT
CAGCTTCTCCCGTCAGATGCAGGGAACAGGAGAAATCGTCACCGCACTGCTCGCCGCATTGCTGGACGGT
GAGAACATGGATGTAATGCTGCGTGGCGTCTGGCTCACATCCTCGCTACAGCGTGGCCAGGTGGATGATA
TTTTCACGCAGTCCGCCGCCCGCCAGTACGGACTGGGTAACAGCTCGCTGGCAACCTGGCCTCTGGTGGA
GACGACGCCGTATTTTACTCGCCGCCTCTTCCCGGAAGTCCTGCTGGCTGAGCCGAACCTGGCGGGTGAA
AACAGCGTCTGGCTGAACAGCTCCCGGCGCAGGCTGACCGCCTTTTCCACCTGTGGCGCGGCACTGGCGG
CATTGATGGTCGGAAGCTGGCACCATTATTACAATCAGAACTGGCAGTCTGGCGTTAACGTACTGGCACA
AGCTAAAGCCTTTATGGACGTACCACCACCGCAGGGAACGGATGAATTCGGCAATCTGCAATTGCCATTG
CTTAACCCGGTACGCGATGCCACCCTGGCCTATGGTGATTATCGCGATCACGGTTTTCTGGCGGATATGG
GATTGTACCAGGGCGCCCGCGTAGGGCCGTATGTGGAGCAAACCTACATTCAGCTTCTTGAGCAGCGTTA
TCTCCCCTCGTTAATGAACGGCCTGATCCGGGATCTAAACATTGCCCCGCCAGAGAGCGAAGAAAAGCTC
GCTGTGCTGCGCGTAGTGCGCATGATGGAAGACAAAAGTGGGCGCAACAACGAGGCGGTAAAACAGTACA
TGGCACGGCGCTGGAGCAATGAATTTCACGGCCAGCGCGATATTCAGGCGCAACTGATGGTGCATCTGGA
CTATGCGCTGGAGCACACCGACTGGCACGCGCAGCGCCAAAGCAGCGACAGCGATGCTGTCAGCCGCTGG
ACCCCCTATGATAAACCGATCATTAATGCGCAGCAGGAACTGAGCAAGCTGCCCATATACCAGCGTGTCT
ACCAGACCCTGCGCACCAAAGCATTAAGCGTGTTGCCCGCCGATTTGAATTTGCGCGACCAGGTTGGTCC
CACCTTCGACAACGTGTTCGTCGCCGGTAATGATGAAAAACTGGTGATCCCGCAGTTCCTCACCCGCTAT
GGACTGCAAAGCTATTTTGTCAAACAGCGTGAGGGCCTCGTTGAGCTGACCGCGCTGGATTCGTGGGTAC
TGAACCTGACGCAAAGCGTCGCCTACAGCGAGGCCGACCGTGAAGAGATCCAGCGCCATATCACCGAACA
GTACATCAGTGACTATACCGCCACCTGGCGTGCCGGAATGGATAACCTCAACGTCCGTGACTATGAGGCC
ATGTCGGCGCTGACCGACGCGCTGGAGCAGATTATCAGCGGCGATCAGCCATTCCAGCGTGCGCTGACGG
CGCTGCGCGATAATACCCACGCGCTGACGCTCTCCGGCAAACTGGATGATAAGGCGAGGGAAGCGGCGAT
AAATGAGATGGATTACCGCCTGTTATCCCGGCTGGGGCATGAGTTCGCACCGGAAAACAGCGCACTGGAG
GAGCAAAAGGACAAGGCGAGTACGCTACAGGCCGTGTACCAGCAACTGACCGAGCTGCACCGTTACCTGC
TGGCGATCCAGAACTCGCCAGTGCCGGGGAAATCGGCGCTGAAAGCAGTACAGCTACGGCTGGATCAAAA
CAGCAGCGATCCAATCTTCGCCACCCGTCAGATGGCAAAAACCCTGCCTGCGCCTCTTAACCGCTGGGTA
GGTAAGCTCGCGGATCAGGCCTGGCATGTGGTGATGGTGGAAGCCGTTCGTTACATGGAAGTGGACTGGC
GCGACAATGTAGTGAAACCCTTCAACGAGCAGCTTGCCGATAACTATCCGTTTAATCCGCGCGCCACACA
GGATGCCTCACTGGATTCGTTTGAACGTTTCTTTAAACCGGATGGCATTCTGGACAATTTCTACAAGAAC
AACCTGCGCCTGTTCCTTGAAAACGATCTGACCTTTGGCGACGACGGCAGAGTGTTAATCCGTGAAGATA
TCCGGCAGCAACTGGATACCGCGCAGAAAATCCGCGACATCTTCTTCAGCCAGCAGAACGGGCTGGGCGC
ACAGTTTGCCGTGGAAACCGTATCGCTTTCCGGCAATAAGCGGCGCAGCGTACTTAACCTGGACGGCCAG
TTAGTGGACTACAGCCAGGGACGCAACTACACCGCCCATCTGGTCTGGCCGAACAACATGCGTGAAGGCA
ATGAAAGCAAGCTGACGCTGATTGGCACCAGCGGCAGAGCACCGCGCAGTATCGCGTTCAGTGGACCGTG
GGCGCAGTTCCGCCTGTTCGGCGCGGGCCAGTTGACCAATGTGACCAGTGACACCTTTAACGTGCGCTTT
AACGTGGACGGCGGCGCAATGGTTTACCAGGTGCATGTGGATACCGAAGATAACCCGTTCACCGGCGGTC
TGTTCAGCCTGTTCCGTTTACCGGATACGTTGTATTAA
 Primer design