SecReT6
Protein ID: 66048186
SecReT6 ID86
T6SS typei4b
Gene symbol-
Locus tagPsyr_4962
StrainPseudomonas syringae pv. syringae B728a
Repliconchromosome [GenBank: NC_007005] [Browse all T6SS(s) in this replicon]
Location [Strand]5882205..5886137 [+]
Producthypothetical protein
NoteTssM
UniProt IDQ4ZLI3
KEGG IDpsb:Psyr_4962
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.80E-61, Aligned region: 182..453
IcmF-related [PF06761], Evalue: 3.90E-41, Aligned region: 498..563
IcmF-related [PF06761], Evalue: 3.90E-41, Aligned region: 679..918
DUF1215 [PF06744], Evalue: 4.20E-24, Aligned region: 1051..1167
MMR_HSR1 [PF01926], Evalue: 2.40E-05, Aligned region: 125..215
MMR_HSR1 [PF01926], Evalue: 2.40E-05, Aligned region: 864..916
MMR_HSR1 [PF01926], Evalue: 2.40E-05, Aligned region: 1014..1050
MMR_HSR1 [PF01926], Evalue: 2.40E-05, Aligned region: 1218..1246
AAA_16 [PF13191], Evalue: 0.00063, Aligned region: 112..235
AAA_16 [PF13191], Evalue: 0.00063, Aligned region: 288..361
AAA_16 [PF13191], Evalue: 0.00063, Aligned region: 466..492
Protein Sequence: 1310 a.a.     [Download]
>gi|66048186|ref|YP_238027.1| unnamed protein product [Pseudomonas syringae pv. syringae B728a]
MKTLLRLLKSFWFLVPILWLISLAVCWFFAPRISWLQGYTLEAMAIISAFYLLLIVLRQYRRIRTEHNLE
NLVQIEVDRSLKSTGEFRDQQVLRDRLKHAIAMLRTDRSAGGGGSSALYDLPWYLVIGMSAAGKTSLLTR
SGLSASIASSANDTESGTQHCDWYFSPEAVMIDTAGRYLRDDQSASEFAAFLRMLKKQRSKAAVNGLVLV
VSLPELLAASSAERNEMGARLVTRIEEYTDCLDANPPIYLMLTKTDQLPGFNQAFDGMDLNERQQPLGMT
FGLNEINTESLRTVLDRKLANLQAHVSRHVDAQIIALGADANSALLNFPNYFAELSAILEQFLQHFARSN
VNGTQLLLRGLYFTSALQTDKQLTPVYEDELSESFVLRPAKPYGAVEEEEEEEEHRKISDRSYFITDTFR
RVIFPDRDLTLYQSRHGRDRSIGPIVIAAALFAGLAFIGWQALSFQKNREWLANISQQLRELEQSPDRAQ
RLASGQGLELLRNQLATIEKYRTKGVPLQLSGGLYRGDDIYFATQTAYLQQLRTQALEPITLKLQLQMRE
FNEFAKTMDPQYGFGAAPAGSDSKTGKARAQGRKLLDRGARNVAAGRPTSLSSIPRSTGDVTNRLTGAAR
NTASQTRSEAIAALRNPATANDAAELSATTGGLSLSEEMLGRLDERQVASIIESYNALKLYLILTQPTTH
PETEFVNAALPVAWADISSEANPISDDVIEDNSPVYVQLLKNGDAPAMPRNEQLIDETRKSLKFFMISSS
LVDREYLRLQLESSRQFPAIGLNDLVPMPGRQLLYGSEAVPAIFTRQGWEEFVKPELIKLVSGNLRNESD
WVLDGEGGDSVVQKANFVREFMSRYKRDYTKVWYTMIDSVGVRRFSDMANATQQLSLLSDVRNSPVKLLL
ASVNDNTQWDVPAVREAQQTGVKRDDGFWGKVTGIFDNKEAAASVLVSPLPAVDDGSLAKRFEPVSRVFA
TQNAEGADSTIMDRYLAALRKLKVRMNNIQRSQDVGKSSKQLISETLEGQPSEVTNVRNYVETTVDTSQG
GLSTSLQSLFSLPIQFAWETLRDPAGEQIAKAWAKQVAKPWEQVMAHRYPIAADSRNEASVKDLQRFVDP
ESGLLPNFKRNEIGNLSDGEGLGMGSGAKAAPLVNPKMVSNIDKASSLGEVIASLSDRDNGFEIMLEPSA
YFTDIIFTLDGQEQHYRNGKTSWSRFSWPGTTTAPGARLDVVTLSGERITVFDYTGRWGLLRMNDSARVA
DLDGIQQRFSWNTAKGPVSLVVRNYGGVKLTDLANVKALSALNATDGRTK
 
Nucleotide Sequence: 3933 bp     [Download]
>gi|66043271|ref|NC_007005.1|:5882205-5886137 Pseudomonas syringae pv. syringae B728a chromosome, complete genome
ATGAAGACATTACTGCGCCTGTTAAAAAGTTTCTGGTTCCTGGTCCCGATACTGTGGCTGATCAGCCTGG
CTGTCTGCTGGTTTTTCGCCCCAAGGATCAGTTGGCTGCAAGGCTACACGCTCGAAGCGATGGCGATCAT
CAGCGCCTTTTACCTGCTGCTGATCGTACTGCGCCAATACCGCCGGATTCGCACCGAACACAACCTCGAG
AATCTGGTTCAGATCGAAGTTGACCGCTCGCTGAAGTCCACTGGCGAGTTCCGTGATCAGCAAGTGCTGC
GCGACCGCCTCAAGCATGCCATTGCCATGCTGCGCACCGATCGTTCGGCAGGCGGCGGCGGCTCCTCGGC
GCTCTACGATCTGCCCTGGTATCTGGTCATCGGCATGTCCGCAGCGGGCAAGACCTCGCTGCTGACCCGC
TCCGGCCTGTCGGCCAGCATTGCCAGCAGCGCCAATGACACGGAAAGCGGCACCCAGCACTGCGACTGGT
ACTTCAGCCCTGAAGCCGTGATGATCGACACCGCTGGCCGCTACCTTCGCGATGATCAGTCCGCCAGCGA
ATTCGCGGCGTTCCTGCGCATGCTCAAAAAGCAGCGCAGCAAGGCCGCCGTCAATGGTCTGGTGCTGGTG
GTCAGCCTGCCGGAACTGTTGGCCGCTTCTTCCGCCGAACGTAACGAAATGGGTGCGCGCCTGGTCACGC
GCATCGAGGAATACACCGATTGCCTGGACGCCAATCCACCGATCTACCTGATGCTGACCAAGACTGACCA
ACTGCCCGGCTTCAACCAGGCCTTCGACGGCATGGACCTGAACGAGCGCCAGCAGCCGCTGGGCATGACG
TTCGGGCTGAACGAGATCAACACCGAAAGCCTGCGCACGGTGCTCGATCGCAAGCTGGCGAACCTGCAGG
CGCATGTCAGTCGCCATGTCGATGCACAGATCATCGCGCTGGGTGCCGATGCCAACAGCGCCCTGCTGAA
CTTCCCCAACTACTTTGCCGAGCTGTCGGCGATACTCGAGCAGTTCCTGCAGCATTTCGCGCGCAGTAAC
GTCAACGGTACTCAGTTGTTGCTGCGCGGCCTGTATTTCACCAGCGCCCTGCAAACCGACAAGCAACTGA
CACCGGTGTATGAAGACGAGCTTTCAGAGTCGTTCGTCCTGCGTCCGGCGAAGCCATACGGTGCAGTGGA
GGAAGAGGAAGAGGAGGAAGAACACCGGAAAATCAGTGATCGCAGTTACTTCATCACCGACACCTTCCGC
CGCGTCATTTTCCCTGACCGTGACCTGACCCTGTACCAGTCACGGCATGGCCGCGACCGCTCTATTGGCC
CGATCGTCATCGCTGCGGCGCTGTTCGCCGGGCTGGCCTTCATCGGCTGGCAAGCCCTGTCGTTCCAGAA
AAACCGCGAGTGGCTGGCCAACATCAGCCAGCAGTTGCGCGAACTGGAGCAGTCCCCGGACCGGGCACAA
CGCCTTGCCTCGGGCCAAGGCCTGGAGCTGCTGCGCAATCAGCTGGCAACCATCGAGAAATACCGCACCA
AGGGCGTACCGCTGCAACTCAGCGGCGGCCTGTACCGTGGCGACGATATCTACTTCGCCACCCAGACCGC
CTACCTGCAGCAACTGCGTACCCAGGCGCTTGAGCCGATCACGCTGAAACTGCAATTGCAGATGCGTGAA
TTCAACGAGTTCGCCAAAACCATGGACCCGCAGTATGGCTTCGGGGCCGCTCCCGCCGGTTCCGACAGCA
AAACCGGCAAGGCGCGTGCGCAAGGCCGGAAACTGCTGGACCGTGGCGCTCGCAACGTCGCGGCAGGCCG
TCCGACCAGCCTGAGCAGCATTCCGCGCAGCACCGGCGACGTGACCAATCGCCTGACCGGCGCCGCGAGA
AACACGGCCAGCCAGACACGCAGCGAGGCCATCGCCGCACTGCGTAACCCGGCCACCGCAAACGATGCGG
CCGAGTTGTCGGCCACCACGGGCGGTCTGTCGCTGTCGGAAGAGATGCTCGGACGACTCGATGAACGGCA
GGTGGCATCCATCATCGAGTCATACAACGCTCTCAAGCTTTATCTGATTCTGACTCAGCCGACCACGCAC
CCGGAAACCGAGTTCGTCAACGCGGCGTTGCCGGTGGCCTGGGCGGATATTTCCAGCGAGGCCAATCCGA
TCAGCGACGACGTCATCGAGGACAACTCGCCGGTCTATGTACAGTTGCTCAAGAACGGCGACGCGCCGGC
CATGCCGCGCAATGAGCAGTTGATCGACGAGACCCGCAAGAGCCTGAAGTTTTTCATGATCTCCAGCTCG
CTGGTGGACCGTGAATACCTGCGCCTGCAACTGGAATCCAGCCGTCAGTTCCCCGCTATCGGCCTGAATG
ATCTGGTGCCGATGCCGGGTCGTCAGTTGCTGTACGGTTCGGAAGCCGTGCCTGCGATTTTCACCCGTCA
GGGCTGGGAAGAGTTCGTGAAGCCCGAGCTGATCAAGCTGGTGTCCGGCAATCTGCGCAACGAATCGGAC
TGGGTGCTCGACGGTGAAGGCGGCGACAGCGTGGTGCAGAAAGCCAACTTCGTCCGTGAGTTCATGTCCC
GTTACAAGCGTGACTACACGAAAGTCTGGTACACCATGATCGACAGCGTGGGCGTACGTCGCTTCAGCGA
CATGGCCAACGCCACGCAGCAGTTGTCATTGCTCAGTGACGTGCGCAATTCGCCGGTCAAGCTGCTGTTG
GCCTCAGTCAACGACAACACGCAATGGGACGTCCCTGCAGTTCGCGAGGCGCAACAGACCGGGGTCAAGC
GCGACGATGGCTTCTGGGGCAAGGTCACCGGCATCTTCGACAACAAGGAAGCGGCTGCCAGCGTACTGGT
CTCGCCGCTGCCTGCAGTGGATGACGGCAGTCTGGCCAAGCGCTTCGAGCCTGTATCGCGGGTTTTCGCC
ACACAGAACGCCGAAGGCGCCGACAGCACCATCATGGATCGCTACCTGGCAGCGCTGCGTAAGCTCAAAG
TGCGGATGAACAACATCCAGCGCTCGCAGGATGTCGGCAAGAGCAGCAAGCAGTTGATCAGCGAAACCCT
CGAAGGGCAGCCGAGCGAAGTCACCAACGTGCGTAACTACGTTGAAACCACGGTCGATACCAGTCAGGGC
GGGCTTTCCACTTCGCTGCAAAGCCTGTTCAGCCTGCCGATTCAGTTCGCCTGGGAAACGCTGCGTGATC
CGGCTGGCGAACAGATCGCCAAAGCCTGGGCCAAACAGGTCGCCAAGCCCTGGGAACAGGTCATGGCTCA
CCGGTACCCGATTGCTGCGGACAGCCGCAACGAGGCCTCGGTGAAAGACCTGCAGCGTTTCGTCGACCCG
GAGTCGGGCCTGCTGCCCAACTTCAAACGCAATGAAATCGGCAACCTGTCCGATGGCGAAGGGCTCGGCA
TGGGCAGTGGTGCCAAGGCGGCGCCGCTGGTCAACCCGAAAATGGTCAGCAACATCGACAAGGCCAGTTC
GCTGGGCGAAGTCATCGCCAGCCTCTCGGACCGCGACAACGGCTTCGAGATCATGCTTGAGCCGTCGGCC
TACTTCACCGATATCATCTTCACGCTGGATGGCCAGGAGCAGCACTACCGCAACGGCAAGACCAGCTGGA
GCCGCTTCTCGTGGCCTGGCACTACCACAGCGCCAGGCGCACGCCTGGATGTGGTCACCCTGTCAGGCGA
ACGCATTACCGTGTTCGACTACACCGGCCGCTGGGGCCTGCTGCGCATGAACGACAGCGCACGCGTCGCT
GACCTCGACGGCATCCAGCAGCGATTCAGCTGGAACACGGCCAAAGGGCCGGTCAGTCTGGTGGTACGCA
ACTATGGCGGCGTGAAGCTGACCGACCTGGCCAACGTCAAGGCGCTGAGCGCGCTTAACGCAACCGATGG
GCGGACCAAGTGA
 Primer design