SecReT6
Protein ID: 66048188
SecReT6 ID86
T6SS typei4b
Gene symbol-
Locus tagPsyr_4964
StrainPseudomonas syringae pv. syringae B728a
Repliconchromosome [GenBank: NC_007005] [Browse all T6SS(s) in this replicon]
Location [Strand]5887089..5889581 [+]
ProductOmpA/MotB protein
NoteTssM
UniProt IDQ4ZLI1
KEGG IDpsb:Psyr_4964
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.20E-67, Aligned region: 85..112
ImcF-related_N [PF14331], Evalue: 2.20E-67, Aligned region: 186..453
OmpA [PF00691], Evalue: 9.20E-15, Aligned region: 715..810
IcmF-related [PF06761], Evalue: 3.90E-07, Aligned region: 94..134
IcmF-related [PF06761], Evalue: 3.90E-07, Aligned region: 508..640
AAA_16 [PF13191], Evalue: 0.0055, Aligned region: 98..257
Protein Sequence: 830 a.a.     [Download]
>gi|66048188|ref|YP_238029.1| unnamed protein product [Pseudomonas syringae pv. syringae B728a]
MNKIKYYFLRYQPYVLGVCFFLAIFIVWSIGRALGFSSMNSLLTGIGLFLLLSAAYVLLLYRGVSQHQNL
EGLLRDDADQAVLNASPADREEVSLLRERLLQSLERLQSNKPNGSNSKDALYALPWYLVVGQPAAGKSTM
LYQSGLNFPYAEREGARVAGLGGTRNCDWFFSSEAVLLDTAGRYMDDQEEAGKWRAFLQLLRQHRQRRPL
NGLIVTVSIHDILQSSVEDQERIAKRLRERIQETHALLEVRLPVYLVFTKCDLVPGFVPFYRQLDDVARG
EVMGKTFPHKGFEQADWGQRFGVAMDELINYWKQIANQQLVLQDIQVTRQDTAVYRFPLELEALKPRLLL
FVDALLRANPYQSAEMLRGFYFTSALDADQPEMGGHTRQVTERFQLESEQEAVDGNVQPHPLFINSLFRK
VIIPDQHLVALYTTNHRERRRKAAWIGGASLVALLLCSLWGWSYWNNKDNIQSISSELAQAAAEDSKATG
QYTEWQTLDRMRFWTSLYYDRHHDEGVPLRLRLGLYRGYDVEPLLRTRYFNRLETVMLKPTADNLTRSLY
LLTTIKVYQRNAKDLMPVTGVDSVEPKALPPDNRAQSIAAFGKATLDTYVMLSRAQREKADPAFLKAKMP
DYWYPAIARQTGKTITANAEAGSNQDYEYASRQINFYSDQIHELDVPRILDNAFLTSSSRNYINSLLTQS
LKAIETITLESDTLFAFGRADFQSLKTEGQNQLSAIAGKLLSTPNIGKIVIAGHADQLGDPQSNMQVSKQ
RAQTIKTYLVGKGVPAELVDAIGEGSEKPLVKCDMQQPRAQLIQCLEPNRRVEIEVRALN
 
Nucleotide Sequence: 2493 bp     [Download]
>gi|66043271|ref|NC_007005.1|:5887089-5889581 Pseudomonas syringae pv. syringae B728a chromosome, complete genome
ATGAACAAGATCAAATACTACTTTTTGCGCTACCAGCCCTACGTTCTAGGGGTCTGCTTTTTCCTGGCGA
TCTTCATCGTCTGGAGCATCGGCCGTGCCCTGGGCTTCAGCTCGATGAACAGTCTGCTGACGGGGATCGG
CCTGTTTCTGCTGTTGTCGGCAGCCTATGTGCTGTTGCTGTACCGAGGTGTATCACAGCACCAGAACCTG
GAAGGCCTGCTGCGTGACGACGCCGATCAGGCGGTGCTCAACGCCAGCCCGGCAGACCGTGAAGAAGTCA
GCCTGCTGCGCGAGCGCCTGCTGCAAAGCCTCGAGCGCCTGCAGAGCAACAAACCGAACGGCAGCAACTC
CAAGGACGCGCTCTACGCCCTGCCCTGGTATCTGGTGGTCGGTCAGCCCGCAGCGGGCAAAAGCACCATG
CTCTATCAGTCGGGCCTCAACTTCCCCTACGCAGAGCGCGAAGGCGCACGCGTGGCCGGGTTGGGTGGCA
CGCGCAATTGTGACTGGTTCTTCAGTTCGGAAGCCGTGCTGCTGGACACGGCCGGTCGCTACATGGACGA
TCAGGAAGAAGCCGGCAAATGGCGCGCTTTTCTGCAATTGCTGCGTCAGCACCGCCAGCGCAGACCGCTC
AACGGCCTGATTGTCACCGTCAGCATTCATGACATCCTGCAGTCCTCGGTGGAGGACCAGGAGCGCATCG
CCAAACGTCTGCGCGAGCGCATCCAGGAAACCCACGCGCTGCTGGAAGTGCGTCTGCCGGTGTATCTGGT
GTTCACCAAGTGCGACCTGGTCCCGGGCTTCGTGCCGTTCTATCGCCAGCTTGACGATGTGGCGCGTGGC
GAAGTGATGGGCAAGACCTTCCCGCACAAGGGCTTCGAGCAAGCCGACTGGGGCCAGCGCTTCGGTGTGG
CGATGGATGAACTGATCAATTACTGGAAACAGATCGCCAACCAGCAACTGGTGCTTCAGGACATCCAGGT
CACTCGTCAGGACACCGCGGTGTATCGCTTCCCGCTGGAGCTGGAAGCCTTGAAACCGCGCCTGCTCCTG
TTCGTCGATGCTCTGCTGCGCGCCAACCCGTATCAAAGCGCCGAGATGCTGCGCGGTTTCTACTTCACCA
GCGCACTGGACGCCGATCAGCCCGAGATGGGCGGACACACCCGCCAGGTCACTGAGCGATTCCAGCTGGA
AAGCGAGCAGGAAGCTGTCGATGGCAATGTCCAGCCGCACCCGCTGTTCATCAACAGCCTGTTCCGCAAG
GTAATCATCCCCGATCAGCATCTGGTGGCGCTGTACACCACCAACCACCGCGAGCGGCGCCGCAAGGCCG
CCTGGATCGGTGGCGCAAGCCTTGTGGCGTTGCTGCTGTGCAGTCTGTGGGGCTGGTCGTACTGGAACAA
CAAGGACAACATCCAGTCCATCTCCAGCGAACTCGCTCAGGCCGCAGCCGAGGACAGCAAGGCCACCGGG
CAGTACACCGAGTGGCAAACGCTGGATCGCATGCGCTTCTGGACTTCGCTTTACTACGATCGTCATCACG
ACGAAGGCGTACCACTGCGCTTGCGTCTGGGTCTCTACCGGGGCTATGACGTCGAGCCGCTGCTGCGCAC
GCGTTACTTCAACCGTCTGGAAACGGTGATGCTCAAACCGACCGCAGACAACCTGACGCGCTCGCTTTAC
CTGCTGACCACCATCAAGGTCTACCAGCGTAATGCCAAGGACCTGATGCCGGTCACCGGCGTCGACAGTG
TCGAGCCCAAGGCGCTGCCGCCGGATAACCGCGCGCAATCCATCGCCGCCTTCGGCAAGGCCACGCTGGA
CACTTACGTGATGTTGTCGCGCGCCCAGCGTGAAAAGGCCGACCCGGCGTTCCTGAAAGCGAAGATGCCT
GATTACTGGTACCCGGCCATCGCGCGTCAGACTGGCAAGACCATCACCGCGAATGCCGAGGCAGGCTCCA
ATCAGGATTACGAGTACGCCAGCCGACAGATCAACTTCTACAGCGATCAGATTCACGAGCTGGACGTGCC
ACGGATTCTCGACAACGCATTTCTGACATCCAGCTCGCGTAATTACATCAACAGCCTGTTGACGCAGTCG
TTGAAGGCTATCGAAACGATCACGCTGGAATCGGACACGCTGTTTGCCTTTGGTCGTGCCGATTTCCAGA
GCCTTAAAACCGAAGGTCAAAATCAGTTGAGCGCGATCGCCGGCAAGCTGTTGAGTACACCGAACATCGG
CAAGATCGTGATTGCAGGTCACGCCGACCAGTTGGGCGACCCGCAAAGCAACATGCAGGTGTCCAAACAG
CGTGCGCAGACCATCAAGACTTACCTGGTCGGCAAGGGCGTGCCCGCCGAGCTGGTGGACGCGATCGGTG
AAGGCAGCGAGAAGCCTCTGGTCAAATGCGACATGCAGCAACCCAGAGCGCAGTTGATTCAGTGCCTTGA
GCCGAATCGACGCGTGGAGATCGAAGTACGCGCGCTCAATTGA
 Primer design