SecReT6
Protein ID: 700289656
SecReT6 ID937
T6SS typei1
Gene symbolevfC
Locus tagevfC
StrainEscherichia coli DE719
RepliconT6SS [GenBank: KM251715] [Browse all T6SS(s) in this replicon]
Location [Strand]2367..5384 [-]
ProductEvfC
NoteTssM
UniProt IDA0A097QQS3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 4.60E-83, Aligned region: 337..650
ImcF-related_N [PF14331], Evalue: 7.70E-60, Aligned region: 40..287
ImcF-related_N [PF14331], Evalue: 7.70E-60, Aligned region: 667..713
DUF1215 [PF06744], Evalue: 2.80E-32, Aligned region: 135..153
DUF1215 [PF06744], Evalue: 2.80E-32, Aligned region: 746..864
Protein Sequence: 1005 a.a.     [Download]
>gi|700289656|ref|AIU68801.1| EvfC [Escherichia coli]
MEYHPLITPRVGNQAVIFDVDGVLTTPGGDDLLRRRLREHWLGWLMQTRARQPLNGLILTLDLPDLLTAD
KSRRETLVQNLRQQLQEIRQSLHCRLPVYVVLTRLDLLNGFAALFHSLDKKDRDAILGVTFTRRAHESDG
WRSELGAFWQTWVQQVNLALSDLVLAQTGAAPRSAVFSFSRQMQGTGEIVTALLAALLDGENMDVMLRGV
WLTSSLQRGQVDDIFTQSAARQYGLGNSSLATWPLVETTPYFTRRLFPEVLLAEPNLAGENSVWLNSSRR
RLTAFSTCGAALAALMVGSWHHYYNQNWQSGVNVLAQAKAFMDVPPPQGTDEFGNLQLPLLNPVRDATLA
YGDYRDHGFLADMGLYQGARVGPYVEQTYIQLLEQRYLPSLMNGLIRDLNIAPPESEEKLAVLRVVRMME
DKSGRNNEAVKQYMARRWSNEFHGQRDIQAQLMVHLDYALEHTDWHAQRQSSDSDAVSRWTPYDKPIINA
QQELSKLPIYQRVYQTLRTKALSVLPADLNLRDQVGPTFDNVFVAGNDEKLVIPQFLTRYGLQSYFVKQR
EGLVELTALDSWVLNLTQSVAYSEADREEIQRHITEQYISDYTATWRAGMDNLNVRDYEAMSALTDALEQ
IISGDQPFQRALTALRDNTHALTLSGKLDDKAREAAINEMDYRLLSRLGHEFAPENSALEEQKDKASTLQ
AVYQQLTELHRYLLAIQNSPVPGKSALKAVQLRLDQNSSDPIFATRQMAKTLPAPLNRWVGKLADQAWHV
VMVEAVRYMEVDWRDNVVKPFNEQLADNYPFNPRATQDASLDSFERFFKPDGILDNFYKNNLRLFLENDL
TFGDDGRVLIREDIRQQLDTAQKIRDIFFSQQNGLGAQFAVETVSLSGNKRRSVLNLDGQLVDYSQGRNY
TAHLVWPNNMREGNESKLTLIGTSGRAPRSIAFSGPWAQFRLFGAGQLTNVTSDTFNVRFNVDGGAMVYQ
VHVDTEDNPFTGGLFSLFRLPDTLY
 
Nucleotide Sequence: 3018 bp     [Download]
>gi|700289653|gb|KM251715|evfC|:2367-5384
GTGGAATACCACCCGCTGATCACACCGCGAGTGGGCAACCAGGCGGTAATTTTCGATGTTGACGGCGTAC
TGACCACTCCCGGCGGGGATGATCTGCTCCGCCGCCGCCTGCGCGAACACTGGCTGGGCTGGCTGATGCA
AACGCGCGCTCGCCAGCCGCTCAACGGTCTTATCCTGACGCTCGATCTTCCCGATCTGCTGACGGCGGAT
AAATCCCGCCGTGAGACACTGGTACAAAATTTGCGCCAGCAACTTCAGGAGATCCGTCAGAGCCTGCACT
GCCGTCTGCCCGTTTACGTGGTGCTGACACGGCTGGATCTGCTGAACGGCTTTGCCGCGCTGTTCCATTC
ACTGGATAAAAAAGACCGCGATGCGATCCTCGGCGTCACATTTACCCGCCGCGCCCATGAAAGTGACGGC
TGGCGCAGCGAACTGGGGGCTTTCTGGCAGACGTGGGTACAACAGGTGAACCTGGCGCTGTCGGATCTGG
TGCTCGCACAAACCGGTGCTGCTCCCCGCAGCGCTGTGTTCAGCTTCTCCCGTCAGATGCAGGGAACAGG
AGAAATCGTCACCGCACTGCTCGCCGCATTGCTGGACGGTGAGAACATGGATGTAATGCTGCGTGGCGTC
TGGCTCACATCCTCGCTACAGCGTGGCCAGGTGGATGATATTTTCACGCAGTCCGCCGCCCGCCAGTACG
GACTGGGTAACAGCTCGCTGGCAACCTGGCCTCTGGTGGAGACGACGCCGTATTTTACTCGCCGCCTCTT
CCCGGAAGTCCTGCTGGCTGAGCCGAACCTGGCGGGTGAAAACAGCGTCTGGCTGAACAGCTCCCGGCGC
AGGCTGACCGCCTTTTCCACCTGTGGCGCGGCACTGGCGGCATTGATGGTCGGAAGCTGGCACCATTATT
ACAATCAGAACTGGCAGTCTGGCGTTAACGTACTGGCACAAGCTAAAGCCTTTATGGACGTACCACCACC
GCAGGGAACGGATGAATTCGGCAATCTGCAATTGCCATTGCTTAACCCGGTACGCGATGCCACCCTGGCC
TATGGTGATTATCGCGATCACGGTTTTCTGGCGGATATGGGATTGTACCAGGGCGCCCGCGTAGGGCCGT
ATGTGGAGCAAACCTACATTCAGCTTCTTGAGCAGCGTTATCTCCCCTCGTTAATGAACGGCCTGATCCG
GGATCTAAACATTGCCCCGCCAGAGAGCGAAGAAAAGCTCGCTGTGCTGCGCGTAGTGCGCATGATGGAA
GACAAAAGTGGGCGCAACAACGAGGCGGTAAAACAGTACATGGCACGGCGCTGGAGCAATGAATTTCACG
GCCAGCGCGATATTCAGGCGCAACTGATGGTGCATCTGGACTATGCGCTGGAGCACACCGACTGGCACGC
GCAGCGCCAAAGCAGCGACAGCGATGCTGTCAGCCGCTGGACCCCCTATGATAAACCGATCATTAATGCG
CAGCAGGAACTGAGCAAGCTGCCCATATACCAGCGTGTCTACCAGACCCTGCGCACCAAAGCATTAAGCG
TGTTGCCCGCCGATTTGAATTTGCGCGACCAGGTTGGTCCCACCTTCGACAACGTGTTCGTCGCCGGTAA
TGATGAAAAACTGGTGATCCCGCAGTTCCTCACCCGCTATGGACTGCAAAGCTATTTTGTCAAACAGCGT
GAGGGCCTCGTTGAGCTGACCGCGCTGGATTCGTGGGTACTGAACCTGACGCAAAGCGTCGCCTACAGCG
AGGCCGACCGTGAAGAGATCCAGCGCCATATCACCGAACAGTACATCAGTGACTATACCGCCACCTGGCG
TGCCGGAATGGATAACCTCAACGTCCGTGACTATGAGGCCATGTCGGCGCTGACCGACGCGCTGGAGCAG
ATTATCAGCGGCGATCAGCCATTCCAGCGTGCGCTGACGGCGCTGCGCGATAATACCCACGCGCTGACGC
TCTCCGGCAAACTGGATGATAAGGCGAGGGAAGCGGCGATAAATGAGATGGATTACCGCCTGTTATCCCG
GCTGGGGCATGAGTTCGCACCGGAAAACAGCGCACTGGAGGAGCAAAAGGACAAGGCGAGTACGCTACAG
GCCGTGTACCAGCAACTGACCGAGCTGCACCGTTACCTGCTGGCGATCCAGAACTCGCCAGTGCCGGGGA
AATCGGCGCTGAAAGCAGTACAGCTACGGCTGGATCAAAACAGCAGCGATCCAATCTTCGCCACCCGTCA
GATGGCAAAAACCCTGCCTGCGCCTCTTAACCGCTGGGTAGGTAAGCTCGCGGATCAGGCCTGGCATGTG
GTGATGGTGGAAGCCGTTCGTTACATGGAAGTGGACTGGCGCGACAATGTAGTGAAACCCTTCAACGAGC
AGCTTGCCGATAACTATCCGTTTAATCCGCGCGCCACACAGGATGCCTCACTGGATTCGTTTGAACGTTT
CTTTAAACCGGATGGCATTCTGGACAATTTCTACAAGAACAACCTGCGCCTGTTCCTTGAAAACGATCTG
ACCTTTGGCGACGACGGCAGAGTGTTAATCCGTGAAGATATCCGGCAGCAACTGGATACCGCGCAGAAAA
TCCGCGACATCTTCTTCAGCCAGCAGAACGGGCTGGGCGCACAGTTTGCCGTGGAAACCGTATCGCTTTC
CGGCAATAAGCGGCGCAGCGTACTTAACCTGGACGGCCAGTTAGTGGACTACAGCCAGGGACGCAACTAC
ACCGCCCATCTGGTCTGGCCGAACAACATGCGTGAAGGCAATGAAAGCAAGCTGACGCTGATTGGCACCA
GCGGCAGAGCACCGCGCAGTATCGCGTTCAGTGGACCGTGGGCGCAGTTCCGCCTGTTCGGCGCGGGCCA
GTTGACCAATGTGACCAGTGACACCTTTAACGTGCGCTTTAACGTGGACGGCGGCGCAATGGTTTACCAG
GTGCATGTGGATACCGAAGATAACCCGTTCACCGGCGGTCTGTTCAGCCTGTTCCGTTTACCGGATACGT
TGTATTAA
 Primer design