SecReT6
Protein ID: 700289657
SecReT6 ID937
T6SS typei1
Gene symbolevfD
Locus tagevfD
StrainEscherichia coli DE719
RepliconT6SS [GenBank: KM251715] [Browse all T6SS(s) in this replicon]
Location [Strand]5416..5895 [-]
ProductEvfD
NoteTssM
UniProt IDA0A097QQS0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 159 a.a.     [Download]
>gi|700289657|ref|AIU68802.1| EvfD [Escherichia coli]
MFKFPTSRLFSTLKSALRPAMPRFKVSATWLLTLAWIFLLVWIWWQGPKWTLYEQHWLAPLANRWLATAV
WGLIALVWLTWRVMKRLQKLEKQQKQQREEEKDPLTVELHRQQQYLDHWLLRLRRHLDNRRYLWQLPWYM
VIGPAGSWQKHAAARGLSV
 
Nucleotide Sequence: 480 bp     [Download]
>gi|700289653|gb|KM251715|evfD|:5416-5895
GTGTTCAAATTTCCCACATCCCGACTGTTCAGCACGTTGAAATCTGCGCTCAGGCCAGCGATGCCGCGGT
TTAAAGTTTCCGCCACCTGGCTACTGACGCTGGCATGGATTTTTCTGCTGGTGTGGATCTGGTGGCAGGG
TCCAAAATGGACGCTCTATGAGCAGCACTGGCTGGCTCCGCTGGCAAACCGCTGGCTGGCGACCGCCGTC
TGGGGACTTATCGCTCTGGTCTGGCTCACCTGGCGGGTGATGAAGCGTCTGCAAAAGCTGGAAAAACAGC
AGAAACAGCAGCGGGAGGAAGAAAAAGATCCGTTGACCGTGGAACTCCACCGCCAGCAGCAATATCTGGA
TCACTGGCTGCTGCGCCTGCGCCGCCATCTGGATAACCGCCGTTATCTGTGGCAGTTGCCGTGGTATATG
GTCATTGGTCCTGCGGGTAGCTGGCAAAAGCACGCTGCTGCGCGAGGGCTTTCCGTCTGA
 Primer design