SecReT6
Protein ID: 70733364
SecReT6 ID35
T6SS typei3
Gene symboltssM
Locus tagPFL_6081
StrainPseudomonas protegens Pf-5
Repliconchromosome [GenBank: NC_004129] [Browse all T6SS(s) in this replicon]
Location [Strand]6904309..6907815 [-]
Producttype VI secretion protein TssM
NoteTssM
UniProt IDQ4K3P4
KEGG IDpfl:PFL_6081
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 4.40E-97, Aligned region: 83..122
ImcF-related_N [PF14331], Evalue: 4.40E-97, Aligned region: 188..448
ImcF-related_N [PF14331], Evalue: 4.40E-97, Aligned region: 700..743
ImcF-related_N [PF14331], Evalue: 4.40E-97, Aligned region: 796..820
IcmF-related [PF06761], Evalue: 6.90E-91, Aligned region: 499..794
DUF1215 [PF06744], Evalue: 2.30E-40, Aligned region: 905..1026
AAA_19 [PF13245], Evalue: 0.0048, Aligned region: 124..141
AAA_16 [PF13191], Evalue: 0.0052, Aligned region: 122..250
AAA_16 [PF13191], Evalue: 0.0052, Aligned region: 600..651
AAA_16 [PF13191], Evalue: 0.0052, Aligned region: 769..800
Protein Sequence: 1168 a.a.     [Download]
>gi|70733364|ref|YP_263139.1| tssM gene product [Pseudomonas fluorescens Pf-5]
MKAFFSFVIRWVIPLLGLIALSLIIWFIGPLLEFLVPEGRRWALIIFIFALWIGYRVFCIIQARRNAAKV
LQSLAADTPPDPDSVATAEELAALRQRMDEALALLKKAKLGGDERRNLYELPWYVIIGPPGSGKTTALVN
SGLHFPLAAQLGAGAVRGVGGTRNCDWWFTDQAVLLDTAGRYTTQDSHATVDKAAWLGFLDLLKTQRSRR
PIDGAFVAISLSDLLLGSEAERAAHAAAIRLRIQELYTQLGVRFPIYLMLTKLDLVPGFMEFFDSLSKEE
RAQVWGMTFALDDGKSGDSPLAHLPAELAALEQRLNERLVERLQQERDPARRDLIYGFPQQFAALKESLQ
SFLEGVFKPNAFEERVLLRGVYFTSGTQEGSPIDRLIGAMAQSMNLDRQHLARQTGTGRSYFIEKLFSAV
AFAERGLVGVNPKVERRRKWIARGALAGTVALVLVVSTLWIISYRANQAYIAQVDQRVGPVRQDVQNLSP
AQRDVLAVLPLLNATRHLAGDAPGWAEGLGLYQGDMLEAESASVYRKLLVAVFAPRLMTRIEEQLHSGGN
SDFLYEGLKAYLMLADSEHYDPDFIKAWITLDWDHTLARDLPPEQRQALTGHLQALFEKHPPNARLDQRL
IDDLRRQLQQLPVAQRVYDRVKRAKLPDGVPDFRLSEAGGRDAALVFTRKSGKPLSEPLSGLFTAKGYRQ
GFLLASLNQAGTLAEEQWVLGRDQADQQNVASLAADVRRLYFQDYLRQWDALLADIDFVPITSVAQAADV
LRILSGPTSPLKKLLVAVAKETDLQQEERLLAAQGQKVEGGVDQLKQRLGNLLGQEQSANPAAVASSEDP
VSAHFAELNSLVSKGEGEPAAIDGLLADMNALYVQVSAMVGASGDALLGEAKNQASAAAARVSLTAERQP
PVVQGLVKSVVGSTTNTMMGGVRNQLNAAWVSEVVNVYRQSLSGRYPMSPGSSRDATLEDFGQFFGTGGV
MDNYFRKYLQPYVNTSTTTWSWQPGAAQKLGISPGVLQTFQRASNIRDAFFRSSGGTQPAVRFELKPVAM
DANISQFLLDLDGQQLSYDHGPSRPVAMQWPNPGSIGVVRLSIMPPSATGRSGITLDGPWAWFRLLEQSD
LTATNSPDRFNLRLRVDGASISYELRASSAFNPFKSRVLSGFSLPERL
 
Nucleotide Sequence: 3507 bp     [Download]
>gi|70728250|ref|NC_004129.6|:c6907815-6904309 Pseudomonas fluorescens Pf-5 chromosome, complete genome
GTGAAGGCGTTTTTCAGTTTTGTGATTCGCTGGGTGATCCCGCTGCTGGGGCTGATCGCCCTGAGCCTGA
TCATCTGGTTCATTGGCCCGTTGCTGGAGTTCCTGGTACCGGAAGGCCGGCGTTGGGCGCTGATCATTTT
CATCTTCGCGCTATGGATCGGCTACCGGGTGTTTTGCATCATCCAGGCCCGTCGGAATGCGGCCAAGGTC
TTGCAGAGCCTGGCCGCCGACACCCCGCCGGACCCGGACAGCGTGGCCACTGCCGAGGAACTGGCCGCCC
TGCGCCAGCGCATGGACGAAGCCCTGGCGCTGCTGAAGAAGGCCAAGCTCGGCGGTGACGAGCGACGCAA
TCTCTACGAGCTGCCGTGGTACGTGATCATCGGTCCGCCGGGTTCCGGCAAGACCACCGCACTGGTCAAT
TCCGGCCTGCATTTCCCCCTGGCCGCCCAGTTGGGCGCCGGTGCCGTACGCGGCGTGGGCGGCACCCGCA
ACTGCGACTGGTGGTTCACCGACCAGGCCGTGCTGCTCGATACCGCCGGCCGCTACACCACTCAGGACAG
CCATGCCACGGTGGACAAGGCAGCCTGGCTGGGCTTTCTCGACCTGCTGAAAACCCAGCGCTCGCGGCGG
CCGATCGATGGCGCCTTCGTTGCCATCAGCCTCTCCGACCTGCTGCTCGGCAGCGAAGCGGAGCGCGCTG
CCCACGCCGCAGCGATCCGCCTGCGGATTCAAGAGCTGTACACCCAGTTGGGAGTGCGCTTCCCGATCTA
CCTGATGCTCACCAAGCTCGATCTGGTGCCGGGTTTCATGGAGTTCTTCGACTCCCTGAGCAAGGAAGAG
CGAGCCCAGGTCTGGGGCATGACCTTCGCCCTGGACGACGGCAAGAGCGGTGACAGCCCCCTGGCCCACC
TGCCGGCGGAACTGGCGGCCCTGGAGCAGCGGCTCAACGAGCGCCTGGTGGAACGCCTGCAGCAGGAACG
CGACCCGGCGCGGCGCGACCTGATCTACGGCTTTCCGCAGCAGTTCGCAGCGCTCAAGGAATCCTTGCAG
AGCTTCCTGGAAGGGGTGTTCAAGCCCAATGCCTTCGAAGAGCGGGTACTGCTGCGCGGGGTGTACTTCA
CCAGCGGCACCCAGGAAGGCAGCCCGATCGACCGCCTGATCGGCGCCATGGCCCAGAGCATGAACCTGGA
CCGCCAGCACCTGGCGCGGCAGACCGGCACCGGGCGCAGCTACTTCATCGAGAAGCTGTTCAGTGCCGTG
GCCTTTGCCGAGCGCGGGCTGGTGGGGGTCAACCCCAAGGTCGAGCGCCGGCGCAAATGGATCGCCCGTG
GCGCCCTGGCTGGCACCGTAGCCCTGGTGCTGGTGGTCAGCACCTTGTGGATCATCAGCTACAGGGCCAA
CCAGGCCTACATTGCCCAGGTCGACCAGCGCGTCGGCCCGGTGCGCCAGGACGTGCAGAACCTCAGCCCG
GCCCAGCGCGATGTGCTGGCGGTGCTGCCGCTGCTCAACGCCACCCGCCACCTGGCCGGCGACGCCCCGG
GCTGGGCCGAAGGCCTGGGCCTGTACCAGGGCGACATGCTCGAAGCCGAGTCCGCCAGCGTCTATCGCAA
GCTGCTGGTGGCGGTGTTCGCCCCACGGTTGATGACCCGCATCGAAGAGCAACTGCACAGCGGCGGCAAC
TCGGACTTCCTCTACGAGGGGCTCAAGGCCTACCTGATGCTGGCGGACAGCGAGCACTACGACCCGGACT
TCATCAAGGCCTGGATCACCCTGGACTGGGATCACACCCTGGCCCGCGACCTGCCGCCCGAGCAACGCCA
GGCCCTGACCGGCCACCTGCAGGCGCTGTTCGAGAAGCATCCGCCCAATGCGCGCCTGGACCAGCGCCTG
ATCGACGACCTGCGCCGCCAGCTGCAACAGCTGCCGGTGGCCCAGCGGGTGTATGACCGGGTCAAGCGCG
CCAAGCTGCCGGACGGCGTGCCGGACTTTCGCCTCAGCGAGGCCGGTGGCCGTGACGCCGCGCTGGTGTT
CACCCGCAAGAGCGGCAAGCCGTTGAGCGAGCCCCTGAGCGGGCTGTTTACCGCCAAGGGCTACCGCCAG
GGCTTCCTCCTGGCCAGCCTCAACCAGGCAGGCACCCTGGCGGAAGAACAGTGGGTGCTGGGTCGCGATC
AGGCCGACCAGCAGAACGTCGCCAGCCTTGCCGCCGACGTGCGCCGCCTGTACTTCCAGGATTACCTGCG
CCAGTGGGACGCCCTGCTGGCGGACATCGACTTCGTGCCGATCACCAGCGTGGCCCAGGCCGCCGACGTG
CTGCGGATTCTTTCCGGGCCCACTTCGCCGCTGAAGAAGCTGCTGGTGGCCGTGGCCAAGGAAACCGACC
TGCAACAGGAAGAACGCCTGCTGGCGGCCCAGGGCCAGAAGGTCGAGGGCGGTGTGGACCAGCTCAAGCA
ACGCCTGGGTAACCTGCTGGGCCAGGAACAGTCGGCCAACCCGGCTGCCGTGGCCAGCAGCGAAGACCCG
GTGAGCGCGCACTTCGCCGAACTCAACAGCCTGGTGAGCAAGGGCGAGGGCGAGCCGGCGGCCATCGACG
GCCTGCTGGCGGACATGAACGCCCTGTACGTGCAGGTCAGCGCCATGGTCGGAGCCAGCGGCGACGCGCT
GCTGGGCGAGGCCAAGAACCAGGCCAGCGCCGCTGCGGCGCGGGTCAGCCTGACCGCCGAGCGTCAGCCT
CCGGTGGTCCAGGGGCTGGTCAAGTCGGTGGTGGGCTCCACCACCAACACCATGATGGGCGGGGTGCGCA
ACCAGCTGAACGCGGCCTGGGTCAGCGAAGTGGTGAACGTCTATCGCCAGTCCCTGAGCGGCCGTTACCC
GATGTCGCCGGGCAGCTCCCGGGACGCGACCCTGGAAGATTTCGGCCAGTTCTTCGGCACCGGCGGGGTG
ATGGACAACTACTTCCGCAAGTACCTGCAGCCCTACGTCAACACCTCGACCACCACCTGGAGCTGGCAGC
CAGGCGCGGCGCAGAAGCTGGGGATTTCCCCTGGCGTGCTGCAGACCTTCCAGCGCGCTTCGAACATTCG
CGACGCCTTCTTCCGCTCCAGTGGCGGTACCCAGCCGGCCGTGCGTTTCGAACTCAAGCCGGTGGCGATG
GACGCCAATATCAGCCAGTTCCTCCTCGACCTGGACGGCCAGCAACTGAGCTACGACCACGGCCCGAGCC
GGCCGGTGGCCATGCAATGGCCCAACCCGGGGAGCATCGGCGTGGTGCGCCTGTCGATCATGCCGCCTTC
GGCCACCGGGCGTTCCGGGATCACCCTGGATGGCCCCTGGGCCTGGTTCCGCCTGCTGGAGCAGTCGGAC
CTGACCGCCACCAATTCGCCGGACCGCTTCAACCTGCGGCTACGGGTGGACGGTGCGAGCATTTCCTACG
AGCTGCGGGCCAGCAGCGCCTTCAACCCGTTCAAGAGCCGGGTGCTCAGTGGCTTCAGCCTGCCGGAGCG
GCTATGA
 Primer design