SecReT6
Protein ID: 71736620
SecReT6 ID55
T6SS typei4b
Gene symbol-
Locus tagPSPPH_0125
StrainPseudomonas syringae pv. phaseolicola 1448A
Repliconchromosome [GenBank: NC_005773] [Browse all T6SS(s) in this replicon]
Location [Strand]144124..148044 [-]
ProductImcF-like family protein
NoteTssM
UniProt IDQ48Q81
KEGG IDpsp:PSPPH_0125
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 4.20E-62, Aligned region: 182..449
IcmF-related [PF06761], Evalue: 2.40E-41, Aligned region: 494..559
IcmF-related [PF06761], Evalue: 2.40E-41, Aligned region: 675..914
DUF1215 [PF06744], Evalue: 3.70E-24, Aligned region: 1047..1163
MMR_HSR1 [PF01926], Evalue: 0.00011, Aligned region: 125..215
MMR_HSR1 [PF01926], Evalue: 0.00011, Aligned region: 861..908
MMR_HSR1 [PF01926], Evalue: 0.00011, Aligned region: 1010..1046
MMR_HSR1 [PF01926], Evalue: 0.00011, Aligned region: 1214..1242
AAA_16 [PF13191], Evalue: 0.001, Aligned region: 112..238
AAA_16 [PF13191], Evalue: 0.001, Aligned region: 288..361
AAA_16 [PF13191], Evalue: 0.001, Aligned region: 461..488
Protein Sequence: 1306 a.a.     [Download]
>gi|71736620|ref|YP_272435.1| unnamed protein product [Pseudomonas syringae pv. phaseolicola 1448A]
MKTLLRLLKSFWFLVPILWLISLAVCWFFAPRISWLQGYTLEAMAIISAFYLLLIVLRQYRRIRTEHNLE
NLVQIEVDRSLKSTGEFRDQQVLRDRLKHAIAMLRTDRSAGGGGSSALYDLPWYLVIGMSAAGKTSLLTR
SGLSASIASSANDTESGTQHCDWYFSPEAVMIDTAGRYLRDDQSASEFAAFLRMLKKQRSKAAVNGLVLV
VSLPELLAASAAERNEMGARLVTRIEEYTDCLDANPPIYLMLTKTDQLPGFNQAFDGMDLHERQQPLGMT
FGLTEITTESLRSVLDRKLANLQAHVSRHVDAQMIALGADANSALLNFPNYFAELSAILEQFLQHFARSN
VNGTQLLLRGLYFTSALQTDKQLTPVYEDELSESFVLRPATAPDALEEDEQRKISDRSYFITDTFRRVIF
PDRDLTLYQSRHGRDKSLGPIVIALALFAGLSFIGWQALSFQKNREWLAAISQQLTELEQSPDRAQRLAS
GQGLELLRNQLAAIEKYRTKGVPLQLSGGLYRGDDIYFATQTAYLQQLRTQALEPITLKLQLQMREFNEF
AKTMDPQYGFGATPAGSETKTGKVRAQGQKLLDRGARNVAAGRPTSLSSIPRSTGEVANRLTGAARGTAS
QTRSEAIAALRNPATANDAAELSATTGGLSLSEEMLGRLDERQVASIIESYNALKLYLILTQPTTHPETE
FVNAALPVAWAGISSETNPISDDVIEDNSPVYVQLLKNGDAPAMPRNEQLIDETRKSLKFFMISSSLVDR
EYLRLQLESSRQFPAIGLNDLVPMPGRQLLYGSEAVPAIFTRQGWEEFVKPELIKLVSGNLRNESDWVLD
GEGGDSVVQKANFVREFMARYKRDYTQVWYTMIDSVGVRRFSDMANATQQLSLLSDVRNSPVKLLLSAVN
DNTQWDVPAPREAQQTGVKRDDGFWGKVSGIFDNKEAAASVLISPLPAVDDGSLAKRFEPVSRVFAAQNA
EGADSTIMDRYLAALRKLKVRMNNIQRSQDVGKSSKQLISETLEGQPSEVTNVRNYVETTVDTSQGGLST
SLQSLFSLPIQFAWETLRDPAGEQIAKAWAKQVAKPWEQVMAHRYPIAADSRNEASVKDLQRFVDPESGL
LPNFKRNEIGNLSDGEGLGMGSGSKAAPLVNPKMVSNIDKASSLGEVIASLSDRDNGFEIMLEPSAYFTD
IIFTLDGQEQHYRNGKTSWSRFSWPGTTTAPGARLDVVTLTGERITVFDYTGRWGLLRMNDSARVADLDG
IQQRFSWNTAKGPVSLVVRNYGGVKLTDLANVKALSALNATDGRTK
 
Nucleotide Sequence: 3921 bp     [Download]
>gi|71733195|ref|NC_005773.3|:c148044-144124 Pseudomonas syringae pv. phaseolicola 1448A chromosome, complete genome
ATGAAGACATTACTGCGCCTGTTAAAAAGTTTCTGGTTCCTGGTACCGATACTGTGGCTGATCAGCCTGG
CTGTCTGCTGGTTTTTCGCCCCCAGGATCAGTTGGCTGCAAGGCTATACGCTTGAAGCGATGGCGATCAT
CAGCGCCTTCTATCTGCTGTTGATCGTACTGCGCCAATACCGACGGATTCGTACAGAACACAACCTCGAA
AATCTGGTTCAGATCGAAGTTGACCGCTCGCTGAAATCCACCGGTGAGTTCCGTGATCAGCAAGTGCTGC
GCGACCGCCTCAAGCATGCCATTGCCATGCTGCGCACCGATCGCTCGGCAGGCGGTGGCGGCTCCTCGGC
GCTCTACGATCTGCCCTGGTATCTGGTCATCGGCATGTCGGCGGCAGGCAAGACCTCCTTGCTGACCCGC
TCCGGCCTGTCGGCCAGCATTGCCAGTAGCGCCAATGACACGGAAAGCGGCACCCAGCATTGCGACTGGT
ACTTCAGCCCTGAAGCAGTGATGATCGACACCGCGGGTCGCTACCTGCGTGACGATCAGTCTGCCAGCGA
ATTCGCTGCGTTCCTGCGTATGCTCAAAAAGCAGCGCAGCAAGGCCGCCGTTAATGGTCTGGTGCTGGTG
GTCAGCCTGCCAGAGCTATTGGCCGCCTCTGCCGCCGAGCGCAACGAGATGGGGGCGCGCTTGGTAACGC
GCATCGAGGAATATACCGATTGCCTGGACGCCAACCCGCCTATTTATCTGATGCTGACCAAGACCGACCA
ACTGCCCGGCTTCAACCAGGCTTTCGACGGTATGGACCTGCATGAGCGCCAGCAGCCGCTGGGCATGACG
TTCGGTCTGACAGAGATCACCACAGAAAGCCTGCGTTCGGTGCTCGATCGCAAACTGGCGAACCTGCAAG
CGCATGTCAGTCGCCACGTCGATGCACAGATGATCGCGCTGGGTGCCGACGCCAACAGCGCCCTGCTCAA
CTTCCCCAACTACTTTGCCGAGCTGTCGGCGATACTCGAACAGTTCCTGCAGCATTTCGCGCGCAGTAAC
GTCAACGGTACCCAGTTGTTGCTGCGCGGCCTGTATTTCACCAGTGCCCTGCAAACCGACAAGCAGCTGA
CACCGGTGTATGAAGACGAGCTTTCAGAGTCGTTCGTCTTGCGGCCAGCGACCGCACCCGATGCGCTGGA
AGAGGACGAACAACGGAAAATCAGTGATCGCAGTTACTTCATCACCGATACCTTCCGCCGCGTCATTTTC
CCTGACCGTGACCTGACCCTGTACCAGTCACGTCATGGCCGCGACAAATCACTGGGGCCGATTGTCATCG
CTCTGGCGCTGTTCGCCGGGCTGTCCTTCATCGGCTGGCAGGCCCTGTCGTTCCAGAAAAACCGCGAGTG
GCTGGCCGCGATCAGCCAACAGTTGACCGAACTGGAACAGTCCCCGGACCGTGCCCAGCGCCTCGCCTCC
GGCCAAGGCCTGGAATTGCTGCGCAACCAGCTGGCTGCCATCGAGAAATACCGCACCAAGGGCGTGCCTC
TTCAGCTCAGTGGCGGCCTGTACCGTGGCGACGATATCTACTTCGCCACCCAGACTGCCTACCTGCAGCA
ACTGCGTACCCAGGCGCTGGAACCGATCACGCTGAAACTGCAATTGCAGATGCGTGAATTCAACGAGTTC
GCCAAAACCATGGACCCGCAGTATGGCTTCGGGGCTACACCCGCAGGGTCGGAAACCAAAACGGGCAAGG
TACGCGCTCAAGGTCAGAAACTGCTGGACCGCGGCGCGCGCAACGTCGCTGCGGGCCGTCCGACCAGCCT
GAGCAGCATCCCGCGCAGCACCGGCGAGGTTGCCAATCGACTGACCGGCGCAGCAAGAGGCACAGCCAGC
CAGACGCGCAGCGAAGCGATTGCCGCGCTACGCAACCCGGCCACTGCCAACGATGCTGCCGAGCTTTCAG
CCACAACAGGCGGCTTGTCGTTGTCGGAAGAGATGCTCGGGCGACTCGATGAACGGCAAGTGGCGTCCAT
CATCGAGTCATACAACGCCCTCAAGCTCTATCTGATTCTGACTCAGCCGACCACGCACCCGGAAACCGAG
TTCGTCAACGCGGCGTTGCCGGTGGCCTGGGCGGGCATTTCCAGCGAGACCAATCCGATCAGCGACGACG
TCATCGAGGACAACTCGCCGGTCTACGTACAGCTGCTCAAGAATGGTGACGCGCCGGCCATGCCACGCAA
TGAGCAACTGATCGACGAGACCCGCAAGAGCCTGAAGTTTTTCATGATCTCCAGTTCGCTGGTGGACCGT
GAATACCTGCGCCTGCAACTGGAATCCAGCCGTCAGTTCCCGGCAATCGGCCTGAATGATCTGGTACCTA
TGCCGGGTCGCCAGTTGCTCTACGGTTCGGAGGCTGTACCTGCGATTTTCACCCGCCAGGGCTGGGAAGA
GTTCGTGAAACCCGAGCTGATCAAGCTGGTGTCCGGCAACCTGCGTAACGAGTCGGACTGGGTTCTGGAT
GGCGAAGGCGGCGACAGCGTGGTGCAGAAAGCCAACTTCGTCCGTGAATTCATGGCCCGCTACAAGCGCG
ACTACACGCAGGTCTGGTACACCATGATCGACAGCGTCGGTGTGCGCCGCTTCAGCGACATGGCCAACGC
CACGCAGCAGTTGTCATTGCTCAGCGACGTACGCAATTCGCCGGTCAAACTGCTGCTGTCTGCCGTCAAC
GACAACACGCAATGGGACGTGCCTGCGCCTCGCGAAGCGCAACAGACCGGAGTCAAACGCGACGATGGCT
TCTGGGGCAAGGTCAGCGGTATCTTCGACAACAAGGAAGCTGCGGCCAGCGTACTGATCTCGCCATTGCC
TGCCGTGGATGACGGCAGTCTGGCCAAACGCTTCGAACCTGTATCAAGGGTTTTCGCAGCGCAGAATGCC
GAAGGCGCTGACAGCACCATCATGGATCGCTACCTGGCAGCGCTGCGTAAACTCAAAGTGCGGATGAACA
ACATCCAGCGCTCGCAGGATGTCGGCAAGAGCAGCAAGCAGTTGATCAGCGAAACCCTTGAAGGGCAGCC
GAGCGAAGTCACCAACGTGCGTAACTACGTTGAAACCACGGTCGATACCAGTCAGGGCGGGCTTTCCACC
TCGCTGCAAAGCCTGTTCAGCCTGCCGATCCAGTTCGCCTGGGAAACGCTACGCGATCCGGCCGGCGAAC
AGATCGCCAAAGCCTGGGCCAAACAGGTCGCCAAACCTTGGGAACAGGTCATGGCGCATCGTTACCCGAT
TGCTGCGGACAGCCGCAACGAGGCATCGGTGAAAGACCTGCAACGCTTCGTCGACCCGGAATCCGGCCTG
CTACCGAACTTCAAGCGCAACGAAATCGGCAACCTGTCCGATGGCGAAGGCCTGGGTATGGGCAGCGGGT
CCAAGGCTGCGCCGCTGGTCAATCCGAAAATGGTCAGCAACATCGACAAGGCCAGTTCGTTGGGCGAGGT
CATCGCCAGCCTCTCGGATCGCGACAATGGTTTCGAGATCATGCTGGAGCCGTCGGCCTACTTCACTGAC
ATCATCTTCACGCTGGATGGCCAGGAGCAGCATTACCGCAACGGCAAAACCAGCTGGAGCCGCTTCTCAT
GGCCGGGCACCACGACAGCACCGGGCGCACGCCTGGATGTGGTCACGCTGACCGGCGAGCGCATCACCGT
GTTCGACTACACCGGGCGCTGGGGACTGCTGCGCATGAACGACAGCGCACGGGTCGCCGACCTGGACGGC
ATTCAGCAGCGTTTCAGTTGGAACACGGCCAAGGGGCCGGTCAGTCTGGTGGTGCGCAACTATGGTGGCG
TGAAGCTGACCGACCTGGCGAACGTCAAGGCGCTGAGCGCGCTTAACGCAACAGATGGGCGGACCAAGTG
A
 Primer design