SecReT6
Protein ID: 71738017
SecReT6 ID55
T6SS typei4b
Gene symbol-
Locus tagPSPPH_0123
StrainPseudomonas syringae pv. phaseolicola 1448A
Repliconchromosome [GenBank: NC_005773] [Browse all T6SS(s) in this replicon]
Location [Strand]140680..143172 [-]
ProductOmpA domain-containing protein
NoteTssM
UniProt IDQ48Q83
KEGG IDpsp:PSPPH_0123
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.10E-67, Aligned region: 83..112
ImcF-related_N [PF14331], Evalue: 3.10E-67, Aligned region: 187..453
OmpA [PF00691], Evalue: 2.70E-15, Aligned region: 715..810
IcmF-related [PF06761], Evalue: 3.90E-07, Aligned region: 94..134
IcmF-related [PF06761], Evalue: 3.90E-07, Aligned region: 508..640
MMR_HSR1 [PF01926], Evalue: 0.0078, Aligned region: 128..244
Protein Sequence: 830 a.a.     [Download]
>gi|71738017|ref|YP_272433.1| unnamed protein product [Pseudomonas syringae pv. phaseolicola 1448A]
MNKIKYYFLRYQPYVLGVCFFLSIFIIWSIGRALGFSSMNSLLTGIGLFLLLSAAYVLLLYRGVSQHQNL
EGLLRDDADQAVLNASPADREEVSLLRERLLQSIERLQSNKPNGSNAKDALYALPWYLVVGQPAAGKSTM
LYQSGLNFPYAEREGARVAGLGGTRNCDWFFSSEAVLLDTAGRYMNDQQEAGKWRAFLQLLRQHRQRRPL
NGLIVTVSIHDILQSSVEDQERIAKRLRERIQETHALLEVRLPVYLVFTKCDLVPGFVPFYRQLDDVARG
EVMGKTFPHKGFEQADWGQRFGVAMDELINYWKEIANQQLVLQDIQITRQDTAVYRFPLELEALKPRLLM
FVDALLRANPYQSAEMLRGFYFTSALDADQPEMGGHTRQVTERFQLESEQDLVDGNAQPHPLFINSLFRK
VIIPDQHLVALYTTNHRERRRKAAWIGGASLVALLICSLWGWSYWNNKDNIQSISTELAQAAADDSKATG
QYTEWQTLDRMRFWTSLYYDRHHDEGVPLRLRLGLYRGYDVEPLLRTRYFNRLETVMLKPTADNLTRSLY
LLTTIKVYQRNAKDLMPVTGVDSVEPKALPPDNRAQSIAAFGKATLDTYVMLSRAQREKADPAFLKAKMP
DYWYPAIARQTGKTITANAEAGSNQDYEYASRQINFYSDQIHELDVPRILDNAFLTSSSRNYINSLLTQS
LKAIETITLESDTLFAFGRADFQSLKTEGQNQLSAIAGKLLSTPNIGKIVIAGHADQLGDPQSNMQVSKQ
RAQTIKTYLVGKGVPAELVDAVGEGSEKPLVNCDMQQPRAQLIQCLEPNRRVEIEVRALN
 
Nucleotide Sequence: 2493 bp     [Download]
>gi|71733195|ref|NC_005773.3|:c143172-140680 Pseudomonas syringae pv. phaseolicola 1448A chromosome, complete genome
ATGAACAAGATCAAATACTACTTTTTGCGCTACCAGCCCTATGTTCTCGGGGTCTGCTTTTTTCTGTCTA
TCTTCATCATCTGGAGCATCGGCCGTGCCCTGGGCTTCAGTTCGATGAACAGCCTGCTGACGGGGATAGG
CCTGTTCCTGCTGCTGTCGGCGGCGTATGTGCTGTTGCTGTATCGGGGCGTATCACAGCATCAGAACCTG
GAGGGTCTGCTGCGTGATGACGCCGATCAGGCCGTGCTCAATGCCAGCCCGGCGGATCGCGAAGAGGTCA
GCCTGCTGCGTGAGCGCTTGCTGCAAAGCATCGAACGGTTGCAGAGCAACAAGCCGAACGGCAGCAACGC
CAAGGACGCGCTTTACGCCCTGCCCTGGTATCTGGTGGTGGGTCAGCCCGCAGCGGGCAAAAGCACCATG
CTGTATCAGTCGGGCCTCAACTTCCCCTACGCCGAGCGCGAAGGCGCACGCGTTGCCGGGCTGGGCGGCA
CGCGCAATTGCGACTGGTTCTTCAGCTCGGAAGCCGTGCTGCTGGATACCGCTGGCCGCTACATGAATGA
TCAGCAGGAAGCCGGCAAATGGCGCGCCTTTCTGCAATTACTGCGTCAGCACCGCCAGCGCAGACCGCTA
AACGGCCTGATTGTCACGGTCAGCATTCATGACATCCTGCAATCCTCGGTGGAGGATCAGGAGCGCATCG
CCAAGCGTCTACGTGAGCGAATCCAGGAAACCCACGCGCTGCTGGAAGTGCGTCTGCCGGTGTATCTGGT
GTTCACCAAGTGCGACCTGGTACCGGGCTTTGTCCCCTTCTATCGCCAGCTGGATGATGTGGCGCGTGGC
GAAGTGATGGGCAAGACCTTCCCGCACAAGGGCTTCGAGCAAGCTGACTGGGGCCAGCGCTTCGGTGTGG
CGATGGACGAGCTGATCAATTATTGGAAAGAGATCGCCAACCAACAGCTGGTGCTTCAGGACATCCAGAT
CACGCGTCAGGACACAGCGGTGTATCGCTTCCCGCTGGAGCTGGAAGCCTTGAAACCGCGCCTGCTGATG
TTCGTCGATGCCCTGCTGCGCGCCAACCCGTATCAGAGCGCCGAGATGCTGCGCGGTTTCTACTTCACCA
GCGCACTGGACGCCGACCAGCCCGAGATGGGCGGACACACCCGTCAGGTGACCGAGCGCTTCCAGCTGGA
AAGCGAGCAGGACCTGGTCGACGGCAATGCGCAGCCGCACCCGCTGTTCATCAACAGCCTGTTCCGCAAG
GTGATCATTCCCGACCAGCATCTGGTGGCGCTGTACACCACCAACCATCGCGAGCGTCGCCGCAAGGCCG
CGTGGATTGGCGGTGCCAGTCTTGTTGCTCTGTTGATCTGCAGCCTGTGGGGCTGGTCGTACTGGAACAA
CAAGGACAACATCCAGTCCATTTCCACCGAACTCGCCCAGGCTGCAGCCGATGACAGCAAAGCCACCGGT
CAGTACACCGAGTGGCAAACGCTGGATCGCATGCGCTTTTGGACTTCGCTTTACTACGATCGTCATCACG
ACGAAGGCGTACCGCTGCGCTTGCGCCTGGGTCTTTACCGGGGCTATGACGTCGAGCCGTTGCTGCGCAC
GCGCTACTTCAACCGTCTGGAAACGGTGATGCTCAAGCCGACCGCAGACAACCTGACGCGCTCGCTTTAC
CTGCTGACCACTATCAAGGTCTACCAGCGCAATGCCAAGGACCTGATGCCGGTCACCGGCGTCGACAGCG
TCGAACCCAAGGCATTGCCGCCGGATAACCGCGCGCAGTCCATCGCGGCCTTCGGCAAGGCGACGCTGGA
TACTTACGTCATGTTGTCGCGAGCGCAGCGCGAGAAGGCTGACCCGGCCTTCCTGAAAGCGAAGATGCCT
GATTACTGGTACCCGGCCATCGCGCGCCAGACCGGCAAGACCATCACTGCGAACGCCGAGGCAGGCTCCA
ATCAGGATTACGAGTACGCCAGCCGCCAGATCAACTTCTACAGCGATCAGATTCACGAACTGGACGTGCC
ACGGATTCTCGACAACGCATTTCTGACATCCAGTTCGCGTAATTACATCAACAGCCTGCTGACGCAGTCG
TTGAAGGCTATCGAAACCATCACGCTGGAATCGGACACCCTGTTTGCCTTTGGTCGTGCCGACTTCCAGA
GCCTGAAAACCGAAGGTCAAAACCAGTTGAGTGCGATCGCCGGCAAGCTGTTGAGCACACCGAACATCGG
CAAGATCGTGATTGCAGGCCACGCCGACCAACTGGGCGACCCGCAAAGCAACATGCAGGTGTCCAAGCAG
CGTGCACAGACCATCAAGACTTATCTGGTCGGCAAGGGCGTGCCCGCCGAGCTGGTGGATGCGGTCGGCG
AAGGCAGCGAGAAACCCTTGGTCAACTGCGATATGCAGCAGCCGAGGGCTCAGTTGATTCAGTGCCTTGA
GCCGAATCGACGCGTAGAGATCGAAGTGCGCGCGCTCAATTGA
 Primer design