SecReT6
Protein ID: 71907810
SecReT6 ID87
T6SS typei4b
Gene symbol-
Locus tagDaro_2188
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T6SS(s) in this replicon]
Location [Strand]2362578..2366390 [-]
Producthypothetical protein
NoteTssM
UniProt IDQ47E04
KEGG IDdar:Daro_2188
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.40E-72, Aligned region: 77..105
ImcF-related_N [PF14331], Evalue: 1.40E-72, Aligned region: 187..445
IcmF-related [PF06761], Evalue: 1.30E-49, Aligned region: 491..834
DUF1215 [PF06744], Evalue: 2.00E-29, Aligned region: 967..1082
Protein Sequence: 1270 a.a.     [Download]
>gi|71907810|ref|YP_285397.1| hypothetical protein Daro_2188 [Dechloromonas aromatica RCB]
MMSQIRSFLTDSRFLSFVGVAAVAAFFFLGAKTLKVAMIWAGIASLAILAVWAVVWFVRRQRARKAGEAI
GSMLEQQADVLPKRSGAATSAEILALKQRMQEAVKTIKTSKLGQVSGAEALYELPWYMTIGNPAAGKSTA
IVNSGLKFPFDDGGDAIIKGIGGTRNCDWFFTTDGILLDTAGRYSVHEEDREEWLGFLGLLKKHRPRAPI
NGIIVTVSIGELMGNSPSFAINLAKSLRQRVQELTEKLEVFAPVYVLFTKVDLIPGFHEFFLDLDWNERD
RVWGATIPYDQSNGNELITLFDRHFDELYEGLRAMSVAQMSRLQGENAPPGLLTFPSEFASIKPALKAFI
ATLFEDNPFQFKPVFRGFYITSAIQSTDIKPVSNDRILRKFSLNGGGSASVRTALSHGYFLKELFSKVIF
PDRNLVRQHTTKAKAQLRQFAVLGALCFLGVALGGWSWSYFNNRSLLANVEQDIAKAVKVQEGRIDLQSR
LEALEIIQDRLAQLEQFNEDHPLSIGLGLYQGELMADKLRREYFAGVNNVMLIPVKDNLEAFLNEVNAQG
DRLKPQGAAVANQAAKPARSKQYKDATPSDVEDGYNALKTYLMLSSHEHVDVGHLSDQMTRFWRGWLEAN
RGTMTREQMIRSAGKVLTFYLEHATHPEWPVIDNNLVLVDEVRDKLRQVVRGMPAAERVYAEIKARASTR
FAPLTVANIVGPDNAALVAGSHVVSGAFTVEAWREYIQNAIKEAATNEQNNADWVLQTSTKDDLTLEGSP
EQIQKSLVVMYKRDYTEEWKQFVQGVSVSSFETFPEAVAAMDRLGDAQMSPVGTLIKVVFDQTAWDNPAM
ANLGLERAQKGFIEWFKRSVLQMAPSRVQMDVNVSAKPAEIPMGPIGKEFAGFGRLVIPRDKADPLVDTY
LKQLSKVRTRLNQLKNQGDPGPGALKLMRETIDGNGSELAETLRFVDEQMLTGLPDNQRAVLRPLLVRPL
LQSYAAIIRPASEELNKTWEAQVYEPFNRKLAIKYPFAAKSNIEASPTEIAQVFGPEGAVSKYVESAMGA
LVVRRGNTVTPRTWGDLGITLQPEFMSDFARWVSPLEGGAATDAGGGAGGAGGQAQTVFMLRPQPSPGTS
GYVIEIDGQKLAYRNGAPQWANFVWPNAAGAPGAKITATTFEGKIVEVINVPGRFGLEKMINAAKRTRQA
DGSFHMTWLADGVEVGIDLRVVSSAQAQAAGNANEGGSAQRGLAGVVLPRSVAVGKAGKYQEPAQETAAP
APVNTGGGVQ
 
Nucleotide Sequence: 3813 bp     [Download]
>gi|71905642|ref|NC_007298.1|:c2366390-2362578 Dechloromonas aromatica RCB, complete genome
ATGATGTCCCAAATCCGTTCGTTTCTGACTGACTCCCGATTTCTTTCATTTGTCGGGGTGGCCGCCGTGG
CGGCATTCTTTTTCCTGGGGGCCAAGACGCTGAAGGTGGCGATGATTTGGGCCGGGATCGCCAGTCTGGC
CATACTCGCTGTCTGGGCTGTGGTCTGGTTCGTGCGCCGGCAAAGGGCACGCAAGGCGGGCGAGGCAATC
GGCTCCATGCTTGAGCAGCAGGCCGATGTTTTGCCAAAGCGTTCTGGTGCCGCGACCTCGGCTGAGATCC
TGGCACTCAAGCAGCGCATGCAGGAGGCGGTCAAGACAATCAAGACCTCCAAGCTTGGCCAGGTCTCCGG
GGCTGAGGCCTTGTATGAATTGCCGTGGTACATGACGATAGGCAACCCGGCAGCCGGGAAAAGTACGGCC
ATCGTCAATTCAGGTCTGAAATTCCCGTTTGACGACGGTGGCGACGCGATCATCAAGGGCATTGGTGGCA
CCCGCAACTGCGATTGGTTTTTCACGACCGATGGCATCCTGCTTGATACGGCGGGCCGTTATTCAGTGCA
TGAAGAAGACCGCGAGGAGTGGCTCGGCTTCCTTGGCTTGCTGAAGAAGCATCGGCCGCGCGCGCCGATC
AACGGCATCATTGTCACCGTCAGCATTGGCGAATTGATGGGTAATTCGCCCAGTTTCGCGATCAACCTGG
CCAAGAGCCTGCGCCAGCGGGTCCAGGAACTGACCGAGAAGCTGGAGGTATTTGCCCCGGTCTATGTGCT
ATTTACCAAGGTCGACCTGATTCCGGGGTTTCATGAATTCTTTCTCGATCTCGACTGGAACGAGCGGGAC
CGGGTTTGGGGGGCGACCATTCCATATGACCAGTCGAACGGCAACGAATTGATCACGCTGTTTGATCGTC
ATTTTGACGAGTTGTATGAAGGTCTGCGTGCCATGAGCGTCGCTCAAATGTCGCGGCTGCAGGGCGAAAA
CGCACCGCCTGGACTGCTGACTTTCCCATCCGAGTTTGCCTCGATCAAACCCGCCCTGAAGGCCTTTATC
GCTACCCTGTTCGAGGATAATCCCTTTCAGTTCAAGCCGGTTTTCCGGGGCTTCTATATCACCTCGGCCA
TCCAGAGCACCGATATCAAGCCGGTCTCCAACGACCGCATCCTGAGAAAGTTTTCCTTGAATGGCGGTGG
CAGTGCTTCAGTGCGTACCGCTTTGAGTCATGGTTACTTCCTGAAGGAACTGTTCTCGAAAGTGATTTTT
CCTGACCGAAATCTGGTCCGCCAGCACACGACCAAGGCAAAGGCTCAGTTACGCCAGTTCGCGGTGCTGG
GGGCCTTGTGTTTCCTGGGCGTAGCACTGGGTGGGTGGAGCTGGTCGTATTTCAATAACCGTAGCCTGCT
GGCCAATGTCGAGCAGGACATCGCCAAGGCTGTGAAGGTGCAGGAGGGGCGGATTGATCTGCAGTCTCGT
CTTGAAGCGCTCGAAATCATCCAGGATCGCCTGGCCCAACTTGAACAATTCAACGAGGATCACCCACTTT
CCATTGGCCTTGGGCTGTATCAAGGTGAGTTGATGGCTGACAAACTACGTCGGGAATACTTTGCCGGCGT
CAATAACGTCATGCTGATTCCGGTCAAGGATAACCTCGAAGCTTTCCTGAACGAGGTCAATGCCCAGGGT
GACCGTCTCAAGCCACAAGGCGCTGCAGTAGCCAATCAGGCCGCCAAGCCGGCGCGTAGCAAACAGTACA
AGGATGCGACGCCTTCCGATGTCGAAGACGGCTACAACGCGCTCAAGACTTACCTGATGCTGTCCAGCCA
CGAGCATGTCGATGTCGGACATCTTTCTGACCAGATGACGCGTTTCTGGCGCGGCTGGCTGGAGGCTAAT
CGCGGCACCATGACGCGCGAGCAGATGATTCGCTCGGCCGGGAAAGTGCTGACCTTCTATCTGGAACACG
CAACGCATCCTGAGTGGCCAGTCATCGACAACAATCTGGTTCTGGTCGATGAAGTGCGCGACAAGCTGCG
CCAGGTCGTACGTGGCATGCCGGCGGCCGAACGAGTCTATGCCGAAATCAAGGCACGGGCATCGACACGC
TTTGCTCCGCTGACCGTCGCCAACATCGTTGGTCCGGACAATGCAGCGCTGGTTGCCGGTAGCCACGTTG
TGTCGGGGGCATTCACGGTTGAGGCATGGCGCGAATACATCCAGAACGCGATCAAGGAAGCGGCAACCAA
TGAACAGAACAACGCGGATTGGGTACTGCAAACCTCGACCAAGGACGATCTGACCCTGGAGGGCAGCCCG
GAGCAGATCCAGAAATCGCTGGTGGTCATGTACAAGCGTGATTACACGGAAGAGTGGAAGCAGTTTGTGC
AGGGGGTCAGTGTCTCATCCTTTGAAACGTTCCCCGAGGCTGTGGCGGCGATGGATCGTTTGGGCGATGC
GCAAATGTCACCGGTCGGCACGCTGATCAAGGTGGTTTTTGACCAGACGGCCTGGGATAACCCGGCGATG
GCCAATCTTGGTCTTGAGCGGGCCCAGAAGGGGTTTATCGAATGGTTCAAGCGATCGGTGCTGCAGATGG
CGCCGAGTCGTGTCCAGATGGATGTCAATGTGTCCGCCAAGCCGGCTGAAATCCCGATGGGGCCGATCGG
CAAGGAGTTTGCCGGATTTGGCCGCTTGGTCATACCGCGCGACAAGGCTGATCCCTTGGTCGATACCTAC
CTTAAGCAGCTATCCAAGGTTCGCACCCGCCTGAATCAACTCAAGAACCAGGGAGATCCTGGGCCGGGAG
CGCTCAAGCTGATGCGGGAAACCATTGATGGCAACGGCTCCGAGTTGGCGGAAACACTCCGTTTCGTCGA
TGAGCAGATGCTGACCGGTCTGCCGGATAATCAGCGTGCCGTCTTGCGTCCGTTGCTGGTTCGCCCTTTG
TTGCAGTCTTATGCCGCGATTATCAGGCCTGCCTCGGAAGAGCTAAACAAGACGTGGGAAGCCCAGGTTT
ACGAGCCGTTTAACCGCAAGCTCGCGATCAAGTATCCGTTTGCCGCAAAATCCAATATCGAGGCTTCGCC
GACTGAAATTGCCCAGGTTTTCGGGCCAGAAGGCGCCGTCTCCAAATACGTTGAATCTGCAATGGGGGCG
TTGGTTGTCCGTCGGGGCAATACCGTGACACCGCGGACCTGGGGGGATCTTGGCATTACCTTGCAGCCTG
AGTTCATGAGCGACTTCGCGCGCTGGGTCTCGCCGCTGGAGGGGGGCGCTGCAACCGATGCCGGCGGTGG
GGCTGGCGGTGCCGGTGGTCAGGCGCAGACCGTCTTCATGTTGCGCCCGCAGCCATCGCCGGGAACCAGC
GGCTACGTGATCGAGATTGACGGGCAGAAGCTGGCTTATCGCAATGGCGCGCCGCAATGGGCCAATTTTG
TCTGGCCGAATGCCGCTGGCGCACCGGGGGCAAAGATCACCGCGACCACGTTCGAGGGCAAAATTGTCGA
GGTCATCAACGTTCCAGGCCGCTTCGGGCTTGAAAAAATGATCAATGCCGCCAAGCGTACCCGTCAGGCC
GATGGTTCGTTCCATATGACCTGGCTGGCAGATGGTGTAGAGGTCGGTATCGACCTCCGCGTGGTCAGCA
GTGCGCAGGCGCAGGCAGCGGGCAACGCGAACGAAGGTGGCAGTGCCCAGCGTGGCCTGGCCGGGGTCGT
ACTGCCCCGATCGGTGGCTGTCGGCAAAGCTGGCAAATATCAGGAACCAGCGCAGGAGACAGCCGCGCCG
GCCCCAGTCAATACGGGAGGAGGTGTCCAATGA
 Primer design